F318226

General Info

Members Datasets Scaffolds Average Seq Length
208 137 416 600

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0063622|Ga0495664_0063622_124_2043
Length 639
Sequence VNRIAENEAPVTNRRGDIMSETFDFVIVGGGSAGAVIASRLSEDPNCRVALIEAGGRPPEVSSMPVACAAMQLNPETDWMYTADPGKAGLGLNGRRVPVPRGKMLGGSSSINYMMYVRGHPGDFDSWVQGGATGWSYDEVLPYFRKSEGLTVDGEVSIDAAAHSNDGPLGVSIQSPVLPAAADFVEAAVAAGIPRGDYNGRDRGGAAGSVSLTQYTTRRGRRSSTYHAFLEGAVEQRPNLTIITGAQATRVIFEGTPGPLTAKGVAYCDAAGENQAVHATKEVILSAGAIGSPHLLLLSGIGPRAELEAAGIPCLLDQPHVGKHLKDHLDVPLFFPAPGVGVSMNEVALSMGPSALRGPDGPLPVDPAGDAALPDAQRAMKQEAERRIAEWETAGRGLAASSLVDAVAFFSTGLGDSHSHDAEVICFLTGGNEDLIGKCLNIDTTRYFDDAAKRLAPDAENILLLANPVLPHSEGEIVITSADPSVHPSIRMNYYDDPHDMKVMVAVVRRTLEIAAHWPGNRKIGPVMIPPFLAEKHGYEVGTDPSDALIEDMALHFSLTVYHHTCTCRIGDVVDPRLRVMGVGRLRVADASVMPNVTSGNTNAPSIMIGEKAGEMIAVDHGVRLRAFVGEPSASRSSP

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
47 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
126 2643221576 Nocardioides sp. Root614 Isolate Unclassified
127 2643221590 Nocardioides sp. Root682 Isolate Unclassified
128 2643221617 Nocardioides sp. Root79 Isolate Unclassified
129 2643221620 Nocardioides sp. Root240 Isolate Unclassified
130 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
131 2643221711 Terrabacter sp. Root85 Isolate Unclassified
132 2738541305 Nocardioides sp. CF167 Isolate Unclassified
133 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
134 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
135 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
136 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
137 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 0.48
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.02
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0063622 3300046477 Bacteria 2199
2 Ga0065707_10092156 3300005295 Plasmid 3816
3 Ga0070709_10077509 3300005434 Bacteria 2161
4 Ga0070714_100023339 3300005435 Bacteria 5080
5 Ga0070714_100026239 3300005435 Bacteria 4813
6 Ga0070714_100077720 3300005435 Bacteria 2883
7 Ga0070713_100019668 3300005436 Bacteria 5164
8 Ga0070713_100020715 3300005436 Bacteria 5047
9 Ga0070713_100070221 3300005436 Bacteria 2956
10 Ga0070710_10008031 3300005437 Bacteria 5131
11 Ga0070710_10019073 3300005437 Bacteria 3540
12 Ga0070710_10027305 3300005437 Bacteria 3042
13 Ga0070711_100066410 3300005439 Bacteria 2526
14 Ga0070678_100084694 3300005456 Bacteria 2414
15 Ga0070698_100007420 3300005471 Bacteria 11866
16 Ga0070696_100066042 3300005546 Bacteria 2537
17 Ga0068859_100011771 3300005617 Bacteria 8789
18 Ga0068859_100023136 3300005617 Bacteria 6234
19 Ga0068864_100007669 3300005618 Bacteria 8888
20 Ga0068862_100022614 3300005844 Bacteria 5259
21 Ga0081455_10000320 3300005937 Bacteria 62754
22 Ga0081455_10002940 3300005937 Bacteria 19956
23 Ga0081455_10003002 3300005937 Bacteria 19681
24 Ga0081455_10019099 3300005937 Bacteria 6497
25 Ga0081538_10000105 3300005981 Bacteria 83102
26 Ga0081538_10008369 3300005981 Bacteria 8795
27 Ga0081538_10019950 3300005981 Bacteria 4955
28 Ga0070717_10029605 3300006028 Bacteria 4393
29 Ga0070717_10138796 3300006028 Bacteria 2095
30 Ga0070716_100019787 3300006173 Bacteria 3524
31 Ga0070712_100061899 3300006175 Bacteria 2645
32 Ga0075428_100004273 3300006844 Bacteria 15724
33 Ga0075428_100017289 3300006844 Bacteria 7970
34 Ga0075428_100020545 3300006844 Bacteria 7312
35 Ga0075428_100031708 3300006844 Bacteria 5838
36 Ga0075430_100006004 3300006846 Bacteria 10251
37 Ga0075430_100036095 3300006846 Bacteria 4191
38 Ga0075430_100050130 3300006846 Bacteria 3522
39 Ga0075431_100004756 3300006847 Bacteria 13351
40 Ga0075431_100028581 3300006847 Bacteria 5733
41 Ga0075433_10021423 3300006852 Bacteria 5420
42 Ga0075434_100007495 3300006871 Bacteria 10098
43 Ga0075434_100054142 3300006871 Bacteria 3986
44 Ga0075429_100024084 3300006880 Bacteria 5279
45 Ga0097620_100011772 3300006931 Bacteria 8789
46 Ga0097620_100023136 3300006931 Bacteria 6234
47 Ga0075435_100002137 3300007076 Bacteria 13024
48 Ga0111539_10003358 3300009094 Bacteria 21130
49 Ga0111539_10024589 3300009094 Bacteria 7388
50 Ga0111539_10068181 3300009094 Bacteria 4200
51 Ga0111539_10141220 3300009094 Bacteria 2819
52 Ga0114129_10000626 3300009147 Bacteria 43994
53 Ga0114129_10040192 3300009147 Bacteria 6594
54 Ga0114129_10063947 3300009147 Bacteria 5135
55 Ga0114129_10069366 3300009147 Bacteria 4913
56 Ga0114129_10171379 3300009147 Bacteria 2959
57 Ga0114129_10278839 3300009147 Bacteria 2234
58 Ga0105248_10120344 3300009177 Bacteria 2962
59 Ga0163162_10034168 3300013306 Bacteria 5059
60 Ga0157375_10232842 3300013308 Bacteria 2001
61 Ga0163163_10060636 3300014325 Unclassified 3747
62 Ga0163163_10161965 3300014325 Bacteria 2283
63 Ga0163163_10180701 3300014325 Unclassified 2157
64 Ga0157380_10004520 3300014326 Bacteria 9650
65 Ga0157380_10146185 3300014326 Bacteria 2038
66 Ga0157380_10146407 3300014326 Bacteria 2036
67 Ga0182008_10017812 3300014497 Bacteria 3682
68 Ga0207699_10048201 3300025906 Bacteria 2502
69 Ga0207699_10063160 3300025906 Bacteria 2236
70 Ga0207693_10037351 3300025915 Bacteria 3828
71 Ga0207693_10040935 3300025915 Bacteria 3649
72 Ga0207693_10097679 3300025915 Bacteria 2303
73 Ga0207700_10057907 3300025928 Bacteria 2924
74 Ga0207664_10005818 3300025929 Bacteria 8432
75 Ga0207664_10013120 3300025929 Bacteria 5941
76 Ga0207664_10083246 3300025929 Bacteria 2608
77 Ga0207658_10042291 3300025986 Bacteria 3304
78 Ga0207641_10003383 3300026088 Bacteria 14158
79 Ga0207676_10065774 3300026095 Bacteria 2888
80 Ga0207674_10019778 3300026116 Bacteria 7286
81 Ga0207675_100065537 3300026118 Bacteria 3395
82 Ga0207683_10109370 3300026121 Bacteria 2474
83 Ga0207428_10006649 3300027907 Bacteria 10615
84 Ga0207428_10065261 3300027907 Bacteria 2873
85 Ga0316182_1131483 3300030745 Unclassified 3156
86 Ga0265760_10002816 3300031090 Bacteria 5081
87 Ga0265327_10000183 3300031251 Bacteria 133191
88 Ga0316575_10012771 3300031665 Bacteria 3130
89 Ga0316579_10000815 3300031691 Bacteria 10760
90 Ga0316579_10012170 3300031691 Bacteria 3675
91 Ga0316577_10022430 3300031733 Bacteria 3505
92 Ga0307407_10022625 3300031903 Bacteria 3266
93 Ga0307409_100070200 3300031995 Bacteria 2780
94 Ga0307416_100067266 3300032002 Bacteria 2954
95 Ga0316574_0008153 3300035398 Bacteria 5797
96 Ga0316574_0091711 3300035398 Bacteria 1937
97 Ga0373935_0079233 3300035692 Bacteria 2132
98 Ga0373933_0021787 3300035724 Bacteria 3644
99 Ga0373947_0067176 3300035725 Bacteria 2189
100 Ga0373937_0048382 3300036401 Bacteria 3893
101 Ga0373937_0079485 3300036401 Bacteria 3031
102 Ga0373937_0123750 3300036401 Bacteria 2411
103 Ga0373937_0152784 3300036401 Unclassified 2162
104 Ga0373937_0176138 3300036401 Bacteria 2008
105 Ga0316582_0004891 3300036647 Bacteria 6842
106 Ga0316584_0007431 3300036712 Bacteria 7491
107 Ga0316584_0008970 3300036712 Bacteria 6916
108 Ga0373925_0072199 3300037068 Bacteria 2611
109 Ga0395900_0019969 3300037418 Bacteria 6830
110 Ga0439432_029182 3300042006 Bacteria 1794
111 Ga0439450_007877 3300042008 Bacteria 1968
112 Ga0466966_0010367 3300044684 Bacteria 6187
113 Ga0466963_0025801 3300044694 Bacteria 3752
114 Ga0466967_0012689 3300045976 Bacteria 6465
115 Ga0466967_0139595 3300045976 Bacteria 2256
116 Ga0495592_0074769 3300046454 Bacteria 2461
117 Ga0495639_0002122 3300046475 Bacteria 8743
118 Ga0495608_0066882 3300046511 Bacteria 2352
119 Ga0495618_0051921 3300046514 Bacteria 2591
120 Ga0495628_0030300 3300046516 Bacteria 4382
121 Ga0495640_0025539 3300046533 Bacteria 4283
122 Ga0495645_0070315 3300046543 Bacteria 2526
123 Ga0495588_0045162 3300046674 Bacteria 2258
124 Ga0495657_0064763 3300046675 Bacteria 2406
125 Ga0495613_0001073 3300046689 Bacteria 20836
126 Ga0495604_0116065 3300047317 Bacteria 1944
127 Ga0495680_0058100 3300047322 Bacteria 2990
128 Ga0495684_0055533 3300047471 Bacteria 3020
129 Ga0495684_0112006 3300047471 Bacteria 2059
130 Ga0496100_0021387 3300048903 Bacteria 3894
131 Ga0496100_0026466 3300048903 Bacteria 3557
132 Ga0496100_0039181 3300048903 Bacteria 3008
133 Ga0496101_0112302 3300048904 Bacteria 2052
134 Ga0496102_0004005 3300048905 Bacteria 12477
135 Ga0496102_0012638 3300048905 Bacteria 7312
136 Ga0496103_0033576 3300048906 Bacteria 3135
137 Ga0496103_0048535 3300048906 Bacteria 2623
138 Ga0496104_0032118 3300048907 Bacteria 4886
139 Ga0496104_0056958 3300048907 Bacteria 3698
140 Ga0496105_0008563 3300048908 Bacteria 7945
141 Ga0496105_0049522 3300048908 Bacteria 3469
142 Ga0496106_0037505 3300048909 Bacteria 3626
143 Ga0496107_0023657 3300048910 Bacteria 4343
144 Ga0496108_0144082 3300048911 Bacteria 2053
145 Ga0496109_0082440 3300048912 Bacteria 2964
146 Ga0496110_0023993 3300048913 Bacteria 5195
147 Ga0496111_0047490 3300048914 Bacteria 3092
148 Ga0496113_0030687 3300048916 Bacteria 3893
149 Ga0496114_0008316 3300048917 Bacteria 8222
150 Ga0496114_0015313 3300048917 Bacteria 6165
151 Ga0496114_0020992 3300048917 Bacteria 5305
152 Ga0496114_0023100 3300048917 Bacteria 5070
153 Ga0496114_0072368 3300048917 Bacteria 2899
154 Ga0496115_0104678 3300048918 Bacteria 2322
155 Ga0501032_0036041 3300049569 Bacteria 3379
156 Ga0501036_0046874 3300049572 Bacteria 3660
157 Ga0501038_0045277 3300049574 Bacteria 3820
158 Ga0501039_0008943 3300049575 Bacteria 7630
159 Ga0501040_0005708 3300049576 Bacteria 8050
160 Ga0501040_0012847 3300049576 Bacteria 5500
161 Ga0501041_0005449 3300049577 Bacteria 7451
162 Ga0501042_0005498 3300049578 Bacteria 8167
163 Ga0501043_0030482 3300049579 Bacteria 4240
164 Ga0501046_0044290 3300049580 Bacteria 3539
165 Ga0501048_0007533 3300049582 Bacteria 8250
166 Ga0501072_0001857 3300049588 Bacteria 15731
167 Ga0501072_0015797 3300049588 Bacteria 5788
168 Ga0501074_0027064 3300049590 Bacteria 4156
169 Ga0501075_0010160 3300049591 Bacteria 6607
170 Ga0501075_0010883 3300049591 Bacteria 6418
171 Ga0501076_0002124 3300049592 Bacteria 13601
172 Ga0501077_0000931 3300049593 Bacteria 17640
173 Ga0501079_0033941 3300049741 Bacteria 3925
174 Ga0501079_0050585 3300049741 Bacteria 3208
175 Ga0501081_0006596 3300049743 Bacteria 7542
176 Ga0501045_0005812 3300049824 Bacteria 8538
177 nmdc:mga05p37_23378_c1 3300050507 Bacteria 7499
178 nmdc:mga05p37_978_c1 3300050507 Bacteria 6432
179 nmdc:mga0qj67_32880_c1 3300050509 Bacteria 4046
180 nmdc:mga0qj67_48340_c1 3300050509 Bacteria 3361
181 nmdc:mga06r32_137948_c1 3300050510 Bacteria 2414
182 nmdc:mga06r32_153465_c1 3300050510 Bacteria 2283
183 nmdc:mga06r32_5098_c1 3300050510 Bacteria 11811
184 nmdc:mga08y16_118462_c1 3300050511 Bacteria 2756
185 nmdc:mga08y16_53604_c1 3300050511 Bacteria 4217
186 nmdc:mga0n895_12018_c1 3300050512 Bacteria 7748
187 nmdc:mga0a205_31751_c1 3300050515 Bacteria 5062
188 Ga0495601_0074535 3300053077 Bacteria 2171
189 Ga0501084_0000821 3300054114 Bacteria 23869
190 Ga0501084_0024374 3300054114 Bacteria 5047
191 Ga0501082_0006146 3300060353 Bacteria 10425
192 Ga0501082_0046951 3300060353 Bacteria 3722
193 Ga0530510_0008387 3300061734 Bacteria 7204
194 Ga0530510_0030458 3300061734 Bacteria 3875
195 Ga0530510_0067179 3300061734 Bacteria 2601
196 2643850124 2643221567 Bacteria 4163945
197 2643891402 2643221576 Bacteria 5214352
198 2643960450 2643221590 Bacteria 5214697
199 2644100272 2643221617 Bacteria 5139111
200 2644116680 2643221620 Bacteria 5134593
201 2644136126 2643221624 Bacteria 4384879
202 2644608299 2643221711 Bacteria 4865335
203 2738869141 2738541305 Bacteria 4910150
204 2812372400 2811994882 Bacteria 4688362
205 2819426090 2818991318 Bacteria 5266538
206 2819690094 2818991462 Bacteria 4320267
207 2819726346 2818991469 Bacteria 4644110
208 2857482305 2857481737 Bacteria 4761446
209 Ga0495664_0063622
210 Ga0065707_10092156
211 Ga0070709_10077509
212 Ga0070714_100023339
213 Ga0070714_100026239
214 Ga0070714_100077720
215 Ga0070713_100019668
216 Ga0070713_100020715
217 Ga0070713_100070221
218 Ga0070710_10008031
219 Ga0070710_10019073
220 Ga0070710_10027305
221 Ga0070711_100066410
222 Ga0070678_100084694
223 Ga0070698_100007420
224 Ga0070696_100066042
225 Ga0068859_100011771
226 Ga0068859_100023136
227 Ga0068864_100007669
228 Ga0068862_100022614
229 Ga0081455_10000320
230 Ga0081455_10002940
231 Ga0081455_10003002
232 Ga0081455_10019099
233 Ga0081538_10000105
234 Ga0081538_10008369
235 Ga0081538_10019950
236 Ga0070717_10029605
237 Ga0070717_10138796
238 Ga0070716_100019787
239 Ga0070712_100061899
240 Ga0075428_100004273
241 Ga0075428_100017289
242 Ga0075428_100020545
243 Ga0075428_100031708
244 Ga0075430_100006004
245 Ga0075430_100036095
246 Ga0075430_100050130
247 Ga0075431_100004756
248 Ga0075431_100028581
249 Ga0075433_10021423
250 Ga0075434_100007495
251 Ga0075434_100054142
252 Ga0075429_100024084
253 Ga0097620_100011772
254 Ga0097620_100023136
255 Ga0075435_100002137
256 Ga0111539_10003358
257 Ga0111539_10024589
258 Ga0111539_10068181
259 Ga0111539_10141220
260 Ga0114129_10000626
261 Ga0114129_10040192
262 Ga0114129_10063947
263 Ga0114129_10069366
264 Ga0114129_10171379
265 Ga0114129_10278839
266 Ga0105248_10120344
267 Ga0163162_10034168
268 Ga0157375_10232842
269 Ga0163163_10060636
270 Ga0163163_10161965
271 Ga0163163_10180701
272 Ga0157380_10004520
273 Ga0157380_10146185
274 Ga0157380_10146407
275 Ga0182008_10017812
276 Ga0207699_10048201
277 Ga0207699_10063160
278 Ga0207693_10037351
279 Ga0207693_10040935
280 Ga0207693_10097679
281 Ga0207700_10057907
282 Ga0207664_10005818
283 Ga0207664_10013120
284 Ga0207664_10083246
285 Ga0207658_10042291
286 Ga0207641_10003383
287 Ga0207676_10065774
288 Ga0207674_10019778
289 Ga0207675_100065537
290 Ga0207683_10109370
291 Ga0207428_10006649
292 Ga0207428_10065261
293 Ga0316182_1131483
294 Ga0265760_10002816
295 Ga0265327_10000183
296 Ga0316575_10012771
297 Ga0316579_10000815
298 Ga0316579_10012170
299 Ga0316577_10022430
300 Ga0307407_10022625
301 Ga0307409_100070200
302 Ga0307416_100067266
303 Ga0316574_0008153
304 Ga0316574_0091711
305 Ga0373935_0079233
306 Ga0373933_0021787
307 Ga0373947_0067176
308 Ga0373937_0048382
309 Ga0373937_0079485
310 Ga0373937_0123750
311 Ga0373937_0152784
312 Ga0373937_0176138
313 Ga0316582_0004891
314 Ga0316584_0007431
315 Ga0316584_0008970
316 Ga0373925_0072199
317 Ga0395900_0019969
318 Ga0439432_029182
319 Ga0439450_007877
320 Ga0466966_0010367
321 Ga0466963_0025801
322 Ga0466967_0012689
323 Ga0466967_0139595
324 Ga0495592_0074769
325 Ga0495639_0002122
326 Ga0495608_0066882
327 Ga0495618_0051921
328 Ga0495628_0030300
329 Ga0495640_0025539
330 Ga0495645_0070315
331 Ga0495588_0045162
332 Ga0495657_0064763
333 Ga0495613_0001073
334 Ga0495604_0116065
335 Ga0495680_0058100
336 Ga0495684_0055533
337 Ga0495684_0112006
338 Ga0496100_0021387
339 Ga0496100_0026466
340 Ga0496100_0039181
341 Ga0496101_0112302
342 Ga0496102_0004005
343 Ga0496102_0012638
344 Ga0496103_0033576
345 Ga0496103_0048535
346 Ga0496104_0032118
347 Ga0496104_0056958
348 Ga0496105_0008563
349 Ga0496105_0049522
350 Ga0496106_0037505
351 Ga0496107_0023657
352 Ga0496108_0144082
353 Ga0496109_0082440
354 Ga0496110_0023993
355 Ga0496111_0047490
356 Ga0496113_0030687
357 Ga0496114_0008316
358 Ga0496114_0015313
359 Ga0496114_0020992
360 Ga0496114_0023100
361 Ga0496114_0072368
362 Ga0496115_0104678
363 Ga0501032_0036041
364 Ga0501036_0046874
365 Ga0501038_0045277
366 Ga0501039_0008943
367 Ga0501040_0005708
368 Ga0501040_0012847
369 Ga0501041_0005449
370 Ga0501042_0005498
371 Ga0501043_0030482
372 Ga0501046_0044290
373 Ga0501048_0007533
374 Ga0501072_0001857
375 Ga0501072_0015797
376 Ga0501074_0027064
377 Ga0501075_0010160
378 Ga0501075_0010883
379 Ga0501076_0002124
380 Ga0501077_0000931
381 Ga0501079_0033941
382 Ga0501079_0050585
383 Ga0501081_0006596
384 Ga0501045_0005812
385 nmdc:mga05p37_23378_c1
386 nmdc:mga05p37_978_c1
387 nmdc:mga0qj67_32880_c1
388 nmdc:mga0qj67_48340_c1
389 nmdc:mga06r32_137948_c1
390 nmdc:mga06r32_153465_c1
391 nmdc:mga06r32_5098_c1
392 nmdc:mga08y16_118462_c1
393 nmdc:mga08y16_53604_c1
394 nmdc:mga0n895_12018_c1
395 nmdc:mga0a205_31751_c1
396 Ga0495601_0074535
397 Ga0501084_0000821
398 Ga0501084_0024374
399 Ga0501082_0006146
400 Ga0501082_0046951
401 Ga0530510_0008387
402 Ga0530510_0030458
403 Ga0530510_0067179
404 2643850124
405 2643891402
406 2643960450
407 2644100272
408 2644116680
409 2644136126
410 2644608299
411 2738869141
412 2812372400
413 2819426090
414 2819690094
415 2819726346
416 2857482305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00732

GMC_oxred_N

GMC oxidoreductase

23

330

0.92

PF05199

GMC_oxred_C

GMC oxidoreductase

471

610

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f8r-assembly2.cif.gz_D crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9057 3 34
3ljp-assembly2.cif.gz_B crystal structure of choline oxidase v464a mutant 0.8837 1 602
3t37-assembly1.cif.gz_A crystal structure of pyridoxine 4-oxidase from mesorbium loti 0.8817 5 597
2jbv-assembly2.cif.gz_B crystal structure of choline oxidase reveals insights into the catalytic mechanism 0.8816 1 602
3nne-assembly7.cif.gz_G crystal structure of choline oxidase s101a mutant 0.8787 1 598
ID Description Score Start End Superfamily
5miqA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9319 5 37 3.50.50.60
3qvrA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9295 1 301 3.50.50.60
1onfA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9221 5 35 3.50.50.60
4zn0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9172 4 35 3.50.50.60
2uzzA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9141 5 37 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A259LZG6-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9742 1 475 GO:0016614
GO:0050660
AF-A0A259LZG6-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9722 1 475 GO:0016614
GO:0050660
AF-T1K715-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9466 1 303 GO:0016020
GO:0016614
GO:0050660
AF-A0A293LKQ7-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9461 1 309 GO:0016614
GO:0050660
AF-A0A2S2PT65-F1-model_v4 Glucose dehydrogenase [acceptor] 0.9419 1 261 GO:0016614
GO:0050660

Map