F318163

General Info

Members Datasets Scaffolds Average Seq Length
208 114 404 133

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0074229|Ga0466965_0074229_716_1210
Length 149
Sequence MVGTKRAFPWVMTPRGTSSMLRQRLARGFTLIELMIYQDYVIRTQVTEGMVLSTGAKGAVWDFVSNTGRFPPNNQSAGLAVNTAISGDYVSSVDVTRGIITVAFNGPGANAAIRTQNLVLSPISHDGSIAWICTPSTLNARYLPTACRQ

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
110 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 4.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 0
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0074229 3300044683 Bacteria 1713
2 JGI24739J22299_10000313 3300001989 Bacteria 16571
3 Ga0058862_12657966 3300004803 Bacteria 593
4 Ga0070658_10006019 3300005327 Bacteria 9841
5 Ga0070658_10558293 3300005327 Bacteria 991
6 Ga0070658_10976948 3300005327 Bacteria 736
7 Ga0070666_10000058 3300005335 Bacteria 89886
8 Ga0070680_100017022 3300005336 Bacteria 5725
9 Ga0070680_100604206 3300005336 Bacteria 941
10 Ga0070680_100951260 3300005336 Bacteria 741
11 Ga0070660_100183802 3300005339 Bacteria 1692
12 Ga0070691_10022456 3300005341 Bacteria 2927
13 Ga0070661_100000626 3300005344 Bacteria 26272
14 Ga0070661_100004997 3300005344 Bacteria 9137
15 Ga0070661_100085734 3300005344 Bacteria 2328
16 Ga0070661_100114825 3300005344 Bacteria 2013
17 Ga0070661_100200602 3300005344 Bacteria 1524
18 Ga0070668_100073701 3300005347 Bacteria 2662
19 Ga0070659_100041602 3300005366 Bacteria 3593
20 Ga0070659_100090632 3300005366 Bacteria 2450
21 Ga0070659_100151929 3300005366 Bacteria 1889
22 Ga0070667_100060181 3300005367 Bacteria 3214
23 Ga0070667_100725862 3300005367 Bacteria 920
24 Ga0070714_100000020 3300005435 Bacteria 169262
25 Ga0070678_100179201 3300005456 Bacteria 1733
26 Ga0070681_10018220 3300005458 Bacteria 7019
27 Ga0070681_10030292 3300005458 Bacteria 5429
28 Ga0070681_10062012 3300005458 Bacteria 3713
29 Ga0070681_10095573 3300005458 Bacteria 2920
30 Ga0070681_10181140 3300005458 Bacteria 2028
31 Ga0070681_10446410 3300005458 Bacteria 1205
32 Ga0070679_100143061 3300005530 Bacteria 2370
33 Ga0070679_100528784 3300005530 Bacteria 1123
34 Ga0070684_101749965 3300005535 Bacteria 586
35 Ga0068853_100003257 3300005539 Bacteria 12408
36 Ga0068853_100053164 3300005539 Bacteria 3488
37 Ga0070665_100011580 3300005548 Bacteria 8918
38 Ga0068855_100003563 3300005563 Bacteria 19040
39 Ga0068855_100011559 3300005563 Bacteria 10662
40 Ga0068855_100331761 3300005563 Bacteria 1679
41 Ga0068857_100393281 3300005577 Bacteria 1289
42 Ga0068856_100021990 3300005614 Bacteria 6201
43 Ga0068856_100038749 3300005614 Bacteria 4679
44 Ga0068852_100126578 3300005616 Bacteria 2347
45 Ga0068864_100156002 3300005618 Bacteria 2072
46 Ga0068863_100274233 3300005841 Bacteria 1633
47 Ga0068863_100278136 3300005841 Bacteria 1621
48 Ga0068858_100183999 3300005842 Bacteria 1973
49 Ga0068858_101447615 3300005842 Bacteria 677
50 Ga0068860_100004648 3300005843 Bacteria 14016
51 Ga0068860_100045581 3300005843 Bacteria 4182
52 Ga0070717_10417878 3300006028 Bacteria 1206
53 Ga0097621_101762197 3300006237 Bacteria 590
54 Ga0105240_10002136 3300009093 Bacteria 32280
55 Ga0105240_10325458 3300009093 Bacteria 1751
56 Ga0105245_10047118 3300009098 Bacteria 3853
57 Ga0105241_10001820 3300009174 Bacteria 16174
58 Ga0105241_10006323 3300009174 Bacteria 8738
59 Ga0105237_10001365 3300009545 Bacteria 32280
60 Ga0105237_10005669 3300009545 Bacteria 14052
61 Ga0105237_10017728 3300009545 Bacteria 7381
62 Ga0105238_10000290 3300009551 Bacteria 55810
63 Ga0105238_10005003 3300009551 Bacteria 13100
64 Ga0105238_10049402 3300009551 Bacteria 4237
65 Ga0105238_10167234 3300009551 Bacteria 2175
66 Ga0105239_10004043 3300010375 Bacteria 17736
67 Ga0105239_10005276 3300010375 Bacteria 15191
68 Ga0105239_10069324 3300010375 Bacteria 3874
69 Ga0105239_10693113 3300010375 Bacteria 1164
70 Ga0157322_1011134 3300012490 Bacteria 737
71 Ga0157373_10190284 3300013100 Bacteria 1446
72 Ga0157373_10220139 3300013100 Bacteria 1339
73 Ga0157373_10221224 3300013100 Bacteria 1336
74 Ga0157371_10023469 3300013102 Bacteria 4511
75 Ga0157371_10157902 3300013102 Bacteria 1619
76 Ga0157371_10742735 3300013102 Bacteria 736
77 Ga0157370_10171985 3300013104 Bacteria 2013
78 Ga0157370_10218889 3300013104 Bacteria 1764
79 Ga0157370_10836468 3300013104 Bacteria 837
80 Ga0157370_11130543 3300013104 Bacteria 707
81 Ga0157369_10003652 3300013105 Bacteria 18258
82 Ga0157369_10521231 3300013105 Bacteria 1229
83 Ga0163162_10004181 3300013306 Bacteria 13875
84 Ga0157372_10000403 3300013307 Bacteria 47787
85 Ga0157372_11542628 3300013307 Bacteria 765
86 Ga0163163_10002184 3300014325 Bacteria 16483
87 Ga0182008_10001315 3300014497 Bacteria 16973
88 Ga0182008_10319277 3300014497 Bacteria 817
89 Ga0157379_10001814 3300014968 Bacteria 17638
90 Ga0182006_1008235 3300015261 Bacteria 4729
91 Ga0182006_1141456 3300015261 Bacteria 822
92 Ga0182007_10028734 3300015262 Bacteria 1909
93 Ga0182007_10063273 3300015262 Bacteria 1212
94 Ga0182005_1135987 3300015265 Bacteria 707
95 Ga0206352_10592387 3300020078 Bacteria 526
96 Ga0206350_11608454 3300020080 Bacteria 1241
97 Ga0207680_10000006 3300025903 Bacteria 635950
98 Ga0207705_10005365 3300025909 Bacteria 9584
99 Ga0207705_10153422 3300025909 Bacteria 1727
100 Ga0207654_10175140 3300025911 Bacteria 1396
101 Ga0207707_10000106 3300025912 Bacteria 83040
102 Ga0207707_10000334 3300025912 Bacteria 49704
103 Ga0207707_10002166 3300025912 Bacteria 17775
104 Ga0207707_10009560 3300025912 Bacteria 8411
105 Ga0207707_10016237 3300025912 Bacteria 6495
106 Ga0207707_10043653 3300025912 Bacteria 3909
107 Ga0207707_10275503 3300025912 Bacteria 1458
108 Ga0207695_10001632 3300025913 Bacteria 36257
109 Ga0207695_10009370 3300025913 Bacteria 12107
110 Ga0207671_10000764 3300025914 Bacteria 40877
111 Ga0207671_10015519 3300025914 Bacteria 5959
112 Ga0207671_10043032 3300025914 Bacteria 3340
113 Ga0207660_10089968 3300025917 Bacteria 2273
114 Ga0207660_10127056 3300025917 Bacteria 1937
115 Ga0207657_10296582 3300025919 Bacteria 1281
116 Ga0207649_10000458 3300025920 Bacteria 29337
117 Ga0207649_10013933 3300025920 Bacteria 4498
118 Ga0207649_10050114 3300025920 Bacteria 2582
119 Ga0207649_10171692 3300025920 Bacteria 1511
120 Ga0207652_10003781 3300025921 Bacteria 12399
121 Ga0207652_10521601 3300025921 Bacteria 1069
122 Ga0207652_10542589 3300025921 Bacteria 1045
123 Ga0207694_10000311 3300025924 Bacteria 45796
124 Ga0207694_10014154 3300025924 Bacteria 6014
125 Ga0207694_10303549 3300025924 Bacteria 1315
126 Ga0207694_10353349 3300025924 Bacteria 1217
127 Ga0207650_11289840 3300025925 Bacteria 622
128 Ga0207664_10000023 3300025929 Bacteria 204730
129 Ga0207690_10000207 3300025932 Bacteria 45657
130 Ga0207690_10014474 3300025932 Bacteria 4765
131 Ga0207690_10060201 3300025932 Bacteria 2576
132 Ga0207711_10156499 3300025941 Bacteria 2060
133 Ga0207667_10013180 3300025949 Bacteria 9477
134 Ga0207667_10024772 3300025949 Bacteria 6581
135 Ga0207667_10089456 3300025949 Bacteria 3182
136 Ga0207667_10282258 3300025949 Bacteria 1697
137 Ga0207668_10078053 3300025972 Bacteria 2390
138 Ga0207658_10485545 3300025986 Bacteria 1098
139 Ga0207703_10172475 3300026035 Bacteria 1904
140 Ga0207639_10000304 3300026041 Bacteria 34871
141 Ga0207639_10024053 3300026041 Bacteria 4403
142 Ga0207702_10011396 3300026078 Bacteria 7412
143 Ga0207702_10046339 3300026078 Bacteria 3660
144 Ga0207641_10254488 3300026088 Bacteria 1641
145 Ga0207641_10414101 3300026088 Bacteria 1296
146 Ga0207676_10159142 3300026095 Bacteria 1954
147 Ga0207674_10432080 3300026116 Bacteria 1273
148 Ga0207683_10414257 3300026121 Bacteria 1240
149 Ga0207698_10149995 3300026142 Bacteria 2022
150 Ga0207698_10260288 3300026142 Bacteria 1593
151 Ga0268266_10000043 3300028379 Bacteria 316604
152 Ga0268264_10007623 3300028381 Bacteria 9022
153 Ga0268264_10698359 3300028381 Bacteria 1007
154 Ga0265762_1122539 3300030760 Bacteria 596
155 Ga0265769_118679 3300030888 Bacteria 538
156 Ga0307516_10026207 3300031730 Bacteria 5923
157 Ga0307516_10765961 3300031730 Bacteria 625
158 Ga0307409_101286519 3300031995 Bacteria 756
159 Ga0307414_10949941 3300032004 Bacteria 790
160 Ga0307510_10007582 3300033180 Bacteria 12929
161 Ga0395899_0010111 3300037312 Bacteria 7234
162 Ga0395900_0214575 3300037418 Bacteria 1942
163 Ga0395898_0498236 3300037466 Bacteria 1158
164 Ga0395901_0034606 3300038443 Bacteria 5217
165 Ga0395901_0146435 3300038443 Bacteria 2482
166 Ga0436365_0362226 3300039437 Bacteria 658
167 Ga0466972_0011613 3300044658 Bacteria 4422
168 Ga0466972_0346723 3300044658 Bacteria 694
169 Ga0466966_0006330 3300044684 Bacteria 7829
170 Ga0466960_0283949 3300044901 Bacteria 928
171 Ga0495650_0000027 3300046471 Bacteria 475071
172 Ga0496121_0367252 3300048924 Bacteria 953
173 Ga0496126_0033329 3300048929 Bacteria 4846
174 Ga0501032_0052816 3300049569 Bacteria 2738
175 Ga0501032_0820467 3300049569 Bacteria 587
176 Ga0501034_0001157 3300049571 Bacteria 36580
177 Ga0501034_0685225 3300049571 Bacteria 924
178 Ga0501043_0405318 3300049579 Bacteria 1030
179 Ga0501043_0461239 3300049579 Bacteria 953
180 Ga0501046_0096814 3300049580 Bacteria 2267
181 Ga0501047_0001315 3300049581 Bacteria 24451
182 Ga0501047_0008409 3300049581 Bacteria 9739
183 Ga0501067_0025110 3300049583 Bacteria 3304
184 Ga0501070_0051822 3300049586 Bacteria 3405
185 Ga0501070_0074321 3300049586 Bacteria 2813
186 Ga0501073_0353694 3300049589 Bacteria 1014
187 Ga0501074_0099374 3300049590 Bacteria 2083
188 Ga0501074_0175513 3300049590 Bacteria 1529
189 Ga0501074_0673773 3300049590 Bacteria 730
190 Ga0501080_0000834 3300049742 Bacteria 25167
191 Ga0501080_0074453 3300049742 Bacteria 3158
192 Ga0501080_0169976 3300049742 Bacteria 2011
193 Ga0501080_0177043 3300049742 Bacteria 1964
194 Ga0501083_0382698 3300049744 Bacteria 915
195 Ga0501035_0249296 3300049822 Bacteria 1508
196 Ga0501044_0196165 3300049823 Bacteria 1979
197 Ga0500646_0016939 3300053090 Bacteria 1907
198 Ga0587070_167532 3300059491 Bacteria 563
199 Ga0587090_110799 3300059510 Bacteria 585
200 Ga0587075_143552 3300059644 Bacteria 512
201 Ga0587076_142823 3300059645 Bacteria 574
202 Ga0501082_0488469 3300060353 Bacteria 1076
203 Ga0466965_0074229
204 JGI24739J22299_10000313
205 Ga0058862_12657966
206 Ga0070658_10006019
207 Ga0070658_10558293
208 Ga0070658_10976948
209 Ga0070666_10000058
210 Ga0070680_100017022
211 Ga0070680_100604206
212 Ga0070680_100951260
213 Ga0070660_100183802
214 Ga0070691_10022456
215 Ga0070661_100000626
216 Ga0070661_100004997
217 Ga0070661_100085734
218 Ga0070661_100114825
219 Ga0070661_100200602
220 Ga0070668_100073701
221 Ga0070659_100041602
222 Ga0070659_100090632
223 Ga0070659_100151929
224 Ga0070667_100060181
225 Ga0070667_100725862
226 Ga0070714_100000020
227 Ga0070678_100179201
228 Ga0070681_10018220
229 Ga0070681_10030292
230 Ga0070681_10062012
231 Ga0070681_10095573
232 Ga0070681_10181140
233 Ga0070681_10446410
234 Ga0070679_100143061
235 Ga0070679_100528784
236 Ga0070684_101749965
237 Ga0068853_100003257
238 Ga0068853_100053164
239 Ga0070665_100011580
240 Ga0068855_100003563
241 Ga0068855_100011559
242 Ga0068855_100331761
243 Ga0068857_100393281
244 Ga0068856_100021990
245 Ga0068856_100038749
246 Ga0068852_100126578
247 Ga0068864_100156002
248 Ga0068863_100274233
249 Ga0068863_100278136
250 Ga0068858_100183999
251 Ga0068858_101447615
252 Ga0068860_100004648
253 Ga0068860_100045581
254 Ga0070717_10417878
255 Ga0097621_101762197
256 Ga0105240_10002136
257 Ga0105240_10325458
258 Ga0105245_10047118
259 Ga0105241_10001820
260 Ga0105241_10006323
261 Ga0105237_10001365
262 Ga0105237_10005669
263 Ga0105237_10017728
264 Ga0105238_10000290
265 Ga0105238_10005003
266 Ga0105238_10049402
267 Ga0105238_10167234
268 Ga0105239_10004043
269 Ga0105239_10005276
270 Ga0105239_10069324
271 Ga0105239_10693113
272 Ga0157322_1011134
273 Ga0157373_10190284
274 Ga0157373_10220139
275 Ga0157373_10221224
276 Ga0157371_10023469
277 Ga0157371_10157902
278 Ga0157371_10742735
279 Ga0157370_10171985
280 Ga0157370_10218889
281 Ga0157370_10836468
282 Ga0157370_11130543
283 Ga0157369_10003652
284 Ga0157369_10521231
285 Ga0163162_10004181
286 Ga0157372_10000403
287 Ga0157372_11542628
288 Ga0163163_10002184
289 Ga0182008_10001315
290 Ga0182008_10319277
291 Ga0157379_10001814
292 Ga0182006_1008235
293 Ga0182006_1141456
294 Ga0182007_10028734
295 Ga0182007_10063273
296 Ga0182005_1135987
297 Ga0206352_10592387
298 Ga0206350_11608454
299 Ga0207680_10000006
300 Ga0207705_10005365
301 Ga0207705_10153422
302 Ga0207654_10175140
303 Ga0207707_10000106
304 Ga0207707_10000334
305 Ga0207707_10002166
306 Ga0207707_10009560
307 Ga0207707_10016237
308 Ga0207707_10043653
309 Ga0207707_10275503
310 Ga0207695_10001632
311 Ga0207695_10009370
312 Ga0207671_10000764
313 Ga0207671_10015519
314 Ga0207671_10043032
315 Ga0207660_10089968
316 Ga0207660_10127056
317 Ga0207657_10296582
318 Ga0207649_10000458
319 Ga0207649_10013933
320 Ga0207649_10050114
321 Ga0207649_10171692
322 Ga0207652_10003781
323 Ga0207652_10521601
324 Ga0207652_10542589
325 Ga0207694_10000311
326 Ga0207694_10014154
327 Ga0207694_10303549
328 Ga0207694_10353349
329 Ga0207650_11289840
330 Ga0207664_10000023
331 Ga0207690_10000207
332 Ga0207690_10014474
333 Ga0207690_10060201
334 Ga0207711_10156499
335 Ga0207667_10013180
336 Ga0207667_10024772
337 Ga0207667_10089456
338 Ga0207667_10282258
339 Ga0207668_10078053
340 Ga0207658_10485545
341 Ga0207703_10172475
342 Ga0207639_10000304
343 Ga0207639_10024053
344 Ga0207702_10011396
345 Ga0207702_10046339
346 Ga0207641_10254488
347 Ga0207641_10414101
348 Ga0207676_10159142
349 Ga0207674_10432080
350 Ga0207683_10414257
351 Ga0207698_10149995
352 Ga0207698_10260288
353 Ga0268266_10000043
354 Ga0268264_10007623
355 Ga0268264_10698359
356 Ga0265762_1122539
357 Ga0265769_118679
358 Ga0307516_10026207
359 Ga0307516_10765961
360 Ga0307409_101286519
361 Ga0307414_10949941
362 Ga0307510_10007582
363 Ga0395899_0010111
364 Ga0395900_0214575
365 Ga0395898_0498236
366 Ga0395901_0034606
367 Ga0395901_0146435
368 Ga0436365_0362226
369 Ga0466972_0011613
370 Ga0466972_0346723
371 Ga0466966_0006330
372 Ga0466960_0283949
373 Ga0495650_0000027
374 Ga0496121_0367252
375 Ga0496126_0033329
376 Ga0501032_0052816
377 Ga0501032_0820467
378 Ga0501034_0001157
379 Ga0501034_0685225
380 Ga0501043_0405318
381 Ga0501043_0461239
382 Ga0501046_0096814
383 Ga0501047_0001315
384 Ga0501047_0008409
385 Ga0501067_0025110
386 Ga0501070_0051822
387 Ga0501070_0074321
388 Ga0501073_0353694
389 Ga0501074_0099374
390 Ga0501074_0175513
391 Ga0501074_0673773
392 Ga0501080_0000834
393 Ga0501080_0074453
394 Ga0501080_0169976
395 Ga0501080_0177043
396 Ga0501083_0382698
397 Ga0501035_0249296
398 Ga0501044_0196165
399 Ga0500646_0016939
400 Ga0587070_167532
401 Ga0587090_110799
402 Ga0587075_143552
403 Ga0587076_142823
404 Ga0501082_0488469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00114

Pilin

Pilin (bacterial filament)

42

148

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v1j-assembly1.cif.gz_A structure of neisseria meningitidis major pillin 0.9162 17 130
2hil-assembly1.cif.gz_A structure of the neisseria gonorrhoeae type iv pilus filament from x-ray crystallography and electron cryomicroscopy 0.9125 12 130
5jw8-assembly1.cif.gz_A crystal structure of the type iv pilin subunit pile from neisseria meningitidis 0.894 23 130
1ay2-assembly1.cif.gz_A structure of the fiber-forming protein pilin at 2.6 angstroms resolution 0.8592 9 130
1qve-assembly1.cif.gz_B crystal structure of the truncated k122-4 pilin from pseudomonas aeruginosa 0.8548 21 130
ID Description Score Start End Superfamily
4xnpA00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.895 23 130 3.30.700.10
1ay2A00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8661 10 130 3.30.700.10
1qveB00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8548 21 130 3.30.700.10
1ay2A00 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.8035 10 130 3.30.700.10
af_P9WQ81_343_427_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.7836 69 84 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A8B2WQQ7-F1-model_v4 deleted 0.9845 24 83
AF-T0YN25-F1-model_v4 Membrane protein containing RDD domain protein 0.9765 12 85 GO:0005886
GO:0007155
GO:0009289
AF-A0A661CKV8-F1-model_v4 Uncharacterized protein 0.9697 22 129 GO:0007155
GO:0009289
AF-A0A1V3Q3Z9-F1-model_v4 Prepilin-type N-terminal cleavage/methylation domain-containing protein 0.9682 12 130 GO:0007155
GO:0009289
AF-A0A3N5PMN5-F1-model_v4 DUF805 domain-containing protein 0.9658 12 97 GO:0007155
GO:0009289
GO:0016020

Map