F318118

General Info

Members Datasets Scaffolds Average Seq Length
208 143 416 138

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0713657|Ga0436365_0713657_144_632
Length 162
Sequence LNKPTREREAVIESKFQDQTKKGDAMQVQPYLNFNGRCQEAIDFYKRAVGAEVQMVMHFKDCPEPQQGMITPENKDKVMHAALKIGDSTVLASDGRCSGSPSFQGISLSLHAKNETEAKRLYGALAEGGQVQMPLAKTFFSPSFGMLADRFGVNWMVIAEQG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 2842718218 Acidovorax sp. R-73343 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.48
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 1.44
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0713657 3300039437 Bacteria 960
2 Ga0055540_1084517 3300003792 Bacteria 605
3 Ga0065715_10061900 3300005293 Bacteria 851
4 Ga0065715_10500599 3300005293 Bacteria 780
5 Ga0065707_10794252 3300005295 Bacteria 602
6 Ga0070658_10070237 3300005327 Bacteria 2867
7 Ga0070670_100089430 3300005331 Bacteria 2647
8 Ga0070670_100875762 3300005331 Bacteria 813
9 Ga0068869_101211146 3300005334 Bacteria 664
10 Ga0070680_100017713 3300005336 Bacteria 5618
11 Ga0070689_100657598 3300005340 Bacteria 912
12 Ga0070661_100056080 3300005344 Bacteria 2886
13 Ga0070661_100822961 3300005344 Bacteria 763
14 Ga0070674_101392701 3300005356 Bacteria 628
15 Ga0070667_100300552 3300005367 Bacteria 1445
16 Ga0070709_10426007 3300005434 Bacteria 995
17 Ga0070709_11058707 3300005434 Bacteria 647
18 Ga0070714_100546471 3300005435 Bacteria 1108
19 Ga0070713_100144105 3300005436 Bacteria 2113
20 Ga0070710_10239649 3300005437 Bacteria 1161
21 Ga0070710_10388079 3300005437 Bacteria 933
22 Ga0070711_100137483 3300005439 Bacteria 1828
23 Ga0070705_100461321 3300005440 Unclassified 955
24 Ga0070708_102077505 3300005445 Bacteria 525
25 Ga0070678_100193392 3300005456 Bacteria 1674
26 Ga0070681_10094145 3300005458 Bacteria 2944
27 Ga0070681_11019144 3300005458 Bacteria 748
28 Ga0068867_100141508 3300005459 Bacteria 1881
29 Ga0068867_100157259 3300005459 Bacteria 1790
30 Ga0068867_100582898 3300005459 Bacteria 973
31 Ga0068867_101364512 3300005459 Bacteria 656
32 Ga0068867_101525740 3300005459 Bacteria 623
33 Ga0070706_100228625 3300005467 Bacteria 1736
34 Ga0070679_100034994 3300005530 Bacteria 4981
35 Ga0070679_100054807 3300005530 Bacteria 3971
36 Ga0070684_102063495 3300005535 Bacteria 538
37 Ga0068853_101517438 3300005539 Bacteria 649
38 Ga0070665_100818754 3300005548 Bacteria 944
39 Ga0068856_100332657 3300005614 Bacteria 1537
40 Ga0068856_100536485 3300005614 Bacteria 1191
41 Ga0068859_101009074 3300005617 Bacteria 914
42 Ga0068863_100474156 3300005841 Bacteria 1230
43 Ga0068863_100683067 3300005841 Bacteria 1020
44 Ga0068858_100003790 3300005842 Bacteria 14951
45 Ga0068858_101822723 3300005842 Bacteria 601
46 Ga0068862_101530011 3300005844 Bacteria 673
47 Ga0081455_10095853 3300005937 Bacteria 2394
48 Ga0081540_1018941 3300005983 Bacteria 4204
49 Ga0070717_10017119 3300006028 Bacteria 5632
50 Ga0075363_100002801 3300006048 Bacteria 7237
51 Ga0070715_10066779 3300006163 Bacteria 1596
52 Ga0070715_10141147 3300006163 Bacteria 1170
53 Ga0075362_10005214 3300006177 Bacteria 4740
54 Ga0075362_10185557 3300006177 Bacteria 1009
55 Ga0075367_10299485 3300006178 Bacteria 1012
56 Ga0075366_10001836 3300006195 Bacteria 10701
57 Ga0097621_100202699 3300006237 Bacteria 1723
58 Ga0075370_10000935 3300006353 Bacteria 12019
59 Ga0068871_102220963 3300006358 Bacteria 523
60 Ga0075428_100644387 3300006844 Bacteria 1130
61 Ga0075436_101064520 3300006914 Bacteria 608
62 Ga0097620_101009072 3300006931 Bacteria 914
63 Ga0105245_10279873 3300009098 Bacteria 1630
64 Ga0105245_10818815 3300009098 Bacteria 970
65 Ga0105247_10163051 3300009101 Bacteria 1477
66 Ga0105243_10692515 3300009148 Bacteria 992
67 Ga0105241_10770232 3300009174 Bacteria 884
68 Ga0105248_10167953 3300009177 Bacteria 2473
69 Ga0105248_10215179 3300009177 Bacteria 2164
70 Ga0105248_11332341 3300009177 Bacteria 812
71 Ga0105248_11967475 3300009177 Bacteria 664
72 Ga0105238_12206243 3300009551 Unclassified 585
73 Ga0105239_10055636 3300010375 Bacteria 4339
74 Ga0105239_10256999 3300010375 Bacteria 1963
75 Ga0105239_12315004 3300010375 Bacteria 625
76 Ga0157369_10160875 3300013105 Bacteria 2370
77 Ga0163162_10259097 3300013306 Bacteria 1871
78 Ga0163162_12654993 3300013306 Unclassified 576
79 Ga0157375_11140025 3300013308 Bacteria 913
80 Ga0157375_12365213 3300013308 Bacteria 634
81 Ga0163163_10100001 3300014325 Bacteria 2922
82 Ga0163163_10447212 3300014325 Bacteria 1352
83 Ga0157380_12334411 3300014326 Bacteria 600
84 Ga0182008_10248014 3300014497 Unclassified 918
85 Ga0182008_10605414 3300014497 Bacteria 615
86 Ga0157379_10025803 3300014968 Bacteria 5224
87 Ga0157379_10456340 3300014968 Bacteria 1180
88 Ga0213876_10017784 3300021384 Bacteria 3752
89 Ga0213875_10000003 3300021388 Bacteria 719367
90 Ga0213875_10000889 3300021388 Bacteria 21877
91 Ga0213871_10133478 3300021441 Bacteria 747
92 Ga0224712_10539404 3300022467 Unclassified 566
93 Ga0209051_1007351 3300025303 Bacteria 6040
94 Ga0209051_1046941 3300025303 Bacteria 1480
95 Ga0207692_10463103 3300025898 Bacteria 800
96 Ga0207685_10063817 3300025905 Bacteria 1469
97 Ga0207685_10111225 3300025905 Bacteria 1187
98 Ga0207699_11204538 3300025906 Bacteria 561
99 Ga0207705_10135003 3300025909 Bacteria 1839
100 Ga0207684_10253859 3300025910 Bacteria 1517
101 Ga0207654_10427572 3300025911 Bacteria 925
102 Ga0207707_10018240 3300025912 Bacteria 6117
103 Ga0207663_10127154 3300025916 Bacteria 1755
104 Ga0207660_10016423 3300025917 Bacteria 4900
105 Ga0207652_10098842 3300025921 Bacteria 2574
106 Ga0207652_10866753 3300025921 Bacteria 799
107 Ga0207650_10206935 3300025925 Bacteria 1574
108 Ga0207687_10635562 3300025927 Bacteria 902
109 Ga0207700_10161071 3300025928 Bacteria 1863
110 Ga0207700_11024175 3300025928 Bacteria 739
111 Ga0207664_10006412 3300025929 Bacteria 8095
112 Ga0207709_10680291 3300025935 Bacteria 822
113 Ga0207670_10221871 3300025936 Bacteria 1447
114 Ga0207665_10043298 3300025939 Bacteria 3010
115 Ga0207665_10712389 3300025939 Bacteria 789
116 Ga0207711_10225972 3300025941 Bacteria 1713
117 Ga0207711_10333252 3300025941 Bacteria 1403
118 Ga0207711_11292433 3300025941 Bacteria 672
119 Ga0207689_10206747 3300025942 Bacteria 1621
120 Ga0207667_11288966 3300025949 Bacteria 707
121 Ga0207651_10125953 3300025960 Bacteria 1952
122 Ga0207640_10457005 3300025981 Bacteria 1054
123 Ga0207658_12053724 3300025986 Bacteria 520
124 Ga0207703_10006693 3300026035 Bacteria 9193
125 Ga0207703_10331008 3300026035 Bacteria 1397
126 Ga0207639_10620893 3300026041 Bacteria 998
127 Ga0207702_10487706 3300026078 Bacteria 1200
128 Ga0207641_11347600 3300026088 Bacteria 714
129 Ga0207648_10397200 3300026089 Bacteria 1249
130 Ga0207648_11227206 3300026089 Bacteria 704
131 Ga0207648_11683073 3300026089 Bacteria 596
132 Ga0207683_10203682 3300026121 Bacteria 1799
133 Ga0207698_10928843 3300026142 Bacteria 878
134 Ga0268266_11137511 3300028379 Bacteria 755
135 Ga0265338_10388527 3300028800 Bacteria 997
136 Ga0265329_10050920 3300031242 Bacteria 1319
137 Ga0265339_10073731 3300031249 Bacteria 1815
138 Ga0307408_100502485 3300031548 Bacteria 1062
139 Ga0307409_100892545 3300031995 Bacteria 902
140 Ga0307409_102445623 3300031995 Bacteria 551
141 Ga0307415_101288895 3300032126 Bacteria 692
142 Ga0316583_10044063 3300032133 Bacteria 1577
143 Ga0373944_0392724 3300035089 Bacteria 534
144 Ga0373923_0047925 3300035111 Bacteria 1783
145 Ga0373941_0212380 3300035115 Bacteria 740
146 Ga0373945_0456748 3300035116 Bacteria 565
147 Ga0373953_0038172 3300035117 Bacteria 1899
148 Ga0373956_0045785 3300035119 Bacteria 1952
149 Ga0373946_0195410 3300035171 Bacteria 967
150 Ga0373955_0050822 3300035172 Bacteria 2256
151 Ga0373961_0008844 3300035241 Bacteria 2455
152 Ga0373924_0032558 3300035410 Bacteria 2101
153 Ga0373924_0035700 3300035410 Bacteria 2017
154 Ga0373935_0372885 3300035692 Bacteria 1021
155 Ga0373935_0468094 3300035692 Bacteria 912
156 Ga0373927_0035697 3300035695 Bacteria 3233
157 Ga0373927_0078650 3300035695 Bacteria 2136
158 Ga0373927_0478218 3300035695 Bacteria 823
159 Ga0373933_0087177 3300035724 Bacteria 1922
160 Ga0373933_0391582 3300035724 Bacteria 906
161 Ga0373947_0233481 3300035725 Bacteria 1212
162 Ga0373947_0721530 3300035725 Bacteria 680
163 Ga0373937_0036312 3300036401 Bacteria 4490
164 Ga0373937_0738408 3300036401 Bacteria 932
165 Ga0373937_1274711 3300036401 Unclassified 683
166 Ga0373925_0514803 3300037068 Bacteria 983
167 Ga0373925_0688809 3300037068 Bacteria 842
168 Ga0436364_0021166 3300037853 Bacteria 914
169 Ga0436364_0291356 3300037853 Bacteria 841
170 Ga0436364_0505381 3300037853 Bacteria 66783
171 Ga0436364_0980821 3300037853 Bacteria 536
172 Ga0436364_1215387 3300037853 Bacteria 105146
173 Ga0436365_0191806 3300039437 Bacteria 1474
174 Ga0436365_0742624 3300039437 Bacteria 1023
175 Ga0436365_1353678 3300039437 Bacteria 2826
176 Ga0436365_1782806 3300039437 Bacteria 1011
177 Ga0436360_0217604 3300039438 Bacteria 554
178 Ga0436360_0771812 3300039438 Unclassified 718
179 Ga0436360_0900564 3300039438 Bacteria 693
180 Ga0436360_1095355 3300039438 Bacteria 768
181 Ga0436361_0243604 3300039447 Plasmid 2878
182 Ga0436361_0917593 3300039447 Bacteria 3017
183 Ga0436361_0934954 3300039447 Bacteria 1358
184 Ga0436361_1193855 3300039447 Bacteria 2006
185 Ga0436362_0486245 3300039453 Bacteria 944
186 Ga0451793_0657354 3300041452 Bacteria 781
187 Ga0451795_0808491 3300041456 Bacteria 708
188 Ga0450922_002860 3300042124 Bacteria 1602
189 Ga0451576_0622093 3300045051 Bacteria 1135
190 Ga0495594_0106255 3300046499 Bacteria 1581
191 Ga0495667_0068303 3300046559 Bacteria 2321
192 Ga0495658_0377146 3300046683 Bacteria 903
193 Ga0495680_0341829 3300047322 Bacteria 1044
194 Ga0496108_0338719 3300048911 Bacteria 1312
195 Ga0501031_0002145 3300049568 Bacteria 12440
196 Ga0501042_1317763 3300049578 Bacteria 527
197 Ga0501047_0426650 3300049581 Bacteria 1157
198 nmdc:mga03683_325451_c1 3300050489 Bacteria 724
199 nmdc:mga03683_83617_c1 3300050489 Bacteria 1382
200 nmdc:mga0k408_3007_c1 3300050493 Bacteria 8946
201 nmdc:mga06z11_124889_c1 3300050494 Bacteria 1439
202 nmdc:mga06z11_273915_c1 3300050494 Bacteria 998
203 nmdc:mga04h51_206373_c1 3300050495 Bacteria 774
204 nmdc:mga07m45_135859_c1 3300050496 Bacteria 702
205 nmdc:mga07m45_3712_c1 3300050496 Bacteria 7387
206 nmdc:mga08y16_1771236_c1 3300050511 Bacteria 571
207 nmdc:mga08x19_851980_c1 3300050514 Bacteria 647
208 2842721621 2842718218 Bacteria 4560148
209 Ga0436365_0713657
210 Ga0055540_1084517
211 Ga0065715_10061900
212 Ga0065715_10500599
213 Ga0065707_10794252
214 Ga0070658_10070237
215 Ga0070670_100089430
216 Ga0070670_100875762
217 Ga0068869_101211146
218 Ga0070680_100017713
219 Ga0070689_100657598
220 Ga0070661_100056080
221 Ga0070661_100822961
222 Ga0070674_101392701
223 Ga0070667_100300552
224 Ga0070709_10426007
225 Ga0070709_11058707
226 Ga0070714_100546471
227 Ga0070713_100144105
228 Ga0070710_10239649
229 Ga0070710_10388079
230 Ga0070711_100137483
231 Ga0070705_100461321
232 Ga0070708_102077505
233 Ga0070678_100193392
234 Ga0070681_10094145
235 Ga0070681_11019144
236 Ga0068867_100141508
237 Ga0068867_100157259
238 Ga0068867_100582898
239 Ga0068867_101364512
240 Ga0068867_101525740
241 Ga0070706_100228625
242 Ga0070679_100034994
243 Ga0070679_100054807
244 Ga0070684_102063495
245 Ga0068853_101517438
246 Ga0070665_100818754
247 Ga0068856_100332657
248 Ga0068856_100536485
249 Ga0068859_101009074
250 Ga0068863_100474156
251 Ga0068863_100683067
252 Ga0068858_100003790
253 Ga0068858_101822723
254 Ga0068862_101530011
255 Ga0081455_10095853
256 Ga0081540_1018941
257 Ga0070717_10017119
258 Ga0075363_100002801
259 Ga0070715_10066779
260 Ga0070715_10141147
261 Ga0075362_10005214
262 Ga0075362_10185557
263 Ga0075367_10299485
264 Ga0075366_10001836
265 Ga0097621_100202699
266 Ga0075370_10000935
267 Ga0068871_102220963
268 Ga0075428_100644387
269 Ga0075436_101064520
270 Ga0097620_101009072
271 Ga0105245_10279873
272 Ga0105245_10818815
273 Ga0105247_10163051
274 Ga0105243_10692515
275 Ga0105241_10770232
276 Ga0105248_10167953
277 Ga0105248_10215179
278 Ga0105248_11332341
279 Ga0105248_11967475
280 Ga0105238_12206243
281 Ga0105239_10055636
282 Ga0105239_10256999
283 Ga0105239_12315004
284 Ga0157369_10160875
285 Ga0163162_10259097
286 Ga0163162_12654993
287 Ga0157375_11140025
288 Ga0157375_12365213
289 Ga0163163_10100001
290 Ga0163163_10447212
291 Ga0157380_12334411
292 Ga0182008_10248014
293 Ga0182008_10605414
294 Ga0157379_10025803
295 Ga0157379_10456340
296 Ga0213876_10017784
297 Ga0213875_10000003
298 Ga0213875_10000889
299 Ga0213871_10133478
300 Ga0224712_10539404
301 Ga0209051_1007351
302 Ga0209051_1046941
303 Ga0207692_10463103
304 Ga0207685_10063817
305 Ga0207685_10111225
306 Ga0207699_11204538
307 Ga0207705_10135003
308 Ga0207684_10253859
309 Ga0207654_10427572
310 Ga0207707_10018240
311 Ga0207663_10127154
312 Ga0207660_10016423
313 Ga0207652_10098842
314 Ga0207652_10866753
315 Ga0207650_10206935
316 Ga0207687_10635562
317 Ga0207700_10161071
318 Ga0207700_11024175
319 Ga0207664_10006412
320 Ga0207709_10680291
321 Ga0207670_10221871
322 Ga0207665_10043298
323 Ga0207665_10712389
324 Ga0207711_10225972
325 Ga0207711_10333252
326 Ga0207711_11292433
327 Ga0207689_10206747
328 Ga0207667_11288966
329 Ga0207651_10125953
330 Ga0207640_10457005
331 Ga0207658_12053724
332 Ga0207703_10006693
333 Ga0207703_10331008
334 Ga0207639_10620893
335 Ga0207702_10487706
336 Ga0207641_11347600
337 Ga0207648_10397200
338 Ga0207648_11227206
339 Ga0207648_11683073
340 Ga0207683_10203682
341 Ga0207698_10928843
342 Ga0268266_11137511
343 Ga0265338_10388527
344 Ga0265329_10050920
345 Ga0265339_10073731
346 Ga0307408_100502485
347 Ga0307409_100892545
348 Ga0307409_102445623
349 Ga0307415_101288895
350 Ga0316583_10044063
351 Ga0373944_0392724
352 Ga0373923_0047925
353 Ga0373941_0212380
354 Ga0373945_0456748
355 Ga0373953_0038172
356 Ga0373956_0045785
357 Ga0373946_0195410
358 Ga0373955_0050822
359 Ga0373961_0008844
360 Ga0373924_0032558
361 Ga0373924_0035700
362 Ga0373935_0372885
363 Ga0373935_0468094
364 Ga0373927_0035697
365 Ga0373927_0078650
366 Ga0373927_0478218
367 Ga0373933_0087177
368 Ga0373933_0391582
369 Ga0373947_0233481
370 Ga0373947_0721530
371 Ga0373937_0036312
372 Ga0373937_0738408
373 Ga0373937_1274711
374 Ga0373925_0514803
375 Ga0373925_0688809
376 Ga0436364_0021166
377 Ga0436364_0291356
378 Ga0436364_0505381
379 Ga0436364_0980821
380 Ga0436364_1215387
381 Ga0436365_0191806
382 Ga0436365_0742624
383 Ga0436365_1353678
384 Ga0436365_1782806
385 Ga0436360_0217604
386 Ga0436360_0771812
387 Ga0436360_0900564
388 Ga0436360_1095355
389 Ga0436361_0243604
390 Ga0436361_0917593
391 Ga0436361_0934954
392 Ga0436361_1193855
393 Ga0436362_0486245
394 Ga0451793_0657354
395 Ga0451795_0808491
396 Ga0450922_002860
397 Ga0451576_0622093
398 Ga0495594_0106255
399 Ga0495667_0068303
400 Ga0495658_0377146
401 Ga0495680_0341829
402 Ga0496108_0338719
403 Ga0501031_0002145
404 Ga0501042_1317763
405 Ga0501047_0426650
406 nmdc:mga03683_325451_c1
407 nmdc:mga03683_83617_c1
408 nmdc:mga0k408_3007_c1
409 nmdc:mga06z11_124889_c1
410 nmdc:mga06z11_273915_c1
411 nmdc:mga04h51_206373_c1
412 nmdc:mga07m45_135859_c1
413 nmdc:mga07m45_3712_c1
414 nmdc:mga08y16_1771236_c1
415 nmdc:mga08x19_851980_c1
416 2842721621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

157

0.85

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

26

158

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8805 1 136
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8556 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8457 1 136
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8444 1 135
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8397 1 136
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9321 81 135 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9145 11 140 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9016 77 136 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8877 77 136 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8464 11 140 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1Y6BHF6-F1-model_v4 PhnB protein 0.9585 1 136
AF-A0A1J5SNH6-F1-model_v4 Uncharacterized protein 0.9584 2 136
AF-A0A258LTQ4-F1-model_v4 PhnB-like domain-containing protein 0.9571 1 139
AF-A0A536UDD0-F1-model_v4 VOC family protein 0.9506 1 136
AF-A0A286D7B4-F1-model_v4 PhnB protein 0.9503 1 140

Map