F317985

General Info

Members Datasets Scaffolds Average Seq Length
208 128 208 174

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10143010|Ga0265338_101430103
Length 186
Sequence MKAPVFFLLLSALCVNTLFVNTRAAFAQQKAPEGIWEGYDGEWVHVSQQLIALAEATPPEKFAYRPAPGVRSTSEVYMHLVIANFYLLSVTGPKMPADLDVSNVEKAEKSVTSKAEVIAWLKHSLEAVKKAHAAVTPKDLQRKVKIADREATVDGMYLRIIVHANEHMGQLIAYARMSGVKPPWAG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 2.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 94.23
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10306942 3300005327 Bacteria 1354
2 Ga0070670_101191280 3300005331 Unclassified 696
3 Ga0070666_10842388 3300005335 Bacteria 676
4 Ga0070682_100146351 3300005337 Bacteria 1616
5 Ga0068868_100288464 3300005338 Unclassified 1391
6 Ga0070667_100303461 3300005367 Bacteria 1438
7 Ga0070709_10052902 3300005434 Bacteria 2555
8 Ga0070709_10085850 3300005434 Bacteria 2065
9 Ga0070709_10192100 3300005434 Unclassified 1441
10 Ga0070714_100050577 3300005435 Bacteria 3541
11 Ga0070714_100337198 3300005435 Bacteria 1413
12 Ga0070713_100011137 3300005436 Bacteria 6536
13 Ga0070713_100022401 3300005436 Bacteria 4882
14 Ga0070713_100029165 3300005436 Unclassified 4367
15 Ga0070713_100159616 3300005436 Bacteria 2012
16 Ga0070713_100262614 3300005436 Unclassified 1578
17 Ga0070713_100928711 3300005436 Bacteria 838
18 Ga0070711_100056027 3300005439 Bacteria 2725
19 Ga0070711_100062912 3300005439 Bacteria 2588
20 Ga0070711_100322596 3300005439 Bacteria 1234
21 Ga0070708_100003788 3300005445 Bacteria 11868
22 Ga0070708_100696870 3300005445 Unclassified 956
23 Ga0070681_10014259 3300005458 Bacteria 7910
24 Ga0070681_10187396 3300005458 Bacteria 1989
25 Ga0070681_10207766 3300005458 Bacteria 1874
26 Ga0070681_10764523 3300005458 Bacteria 883
27 Ga0070706_100267830 3300005467 Unclassified 1594
28 Ga0070707_100953566 3300005468 Unclassified 823
29 Ga0070698_100331708 3300005471 Bacteria 1452
30 Ga0070699_100137390 3300005518 Bacteria 2157
31 Ga0070679_100103428 3300005530 Bacteria 2834
32 Ga0070684_100085864 3300005535 Unclassified 2791
33 Ga0068853_100005588 3300005539 Bacteria 9875
34 Ga0068853_100017188 3300005539 Bacteria 5969
35 Ga0070696_100331091 3300005546 Bacteria 1174
36 Ga0070693_100136234 3300005547 Bacteria 1541
37 Ga0070693_100958402 3300005547 Unclassified 645
38 Ga0070693_101115502 3300005547 Unclassified 602
39 Ga0070664_100922597 3300005564 Bacteria 819
40 Ga0068854_100165965 3300005578 Unclassified 1714
41 Ga0068854_100231919 3300005578 Bacteria 1465
42 Ga0068854_101208011 3300005578 Bacteria 678
43 Ga0068856_100650618 3300005614 Bacteria 1074
44 Ga0068852_100025582 3300005616 Bacteria 4785
45 Ga0068859_100881213 3300005617 Bacteria 980
46 Ga0068851_10019945 3300005834 Unclassified 3242
47 Ga0068851_10077189 3300005834 Unclassified 1734
48 Ga0068863_100035948 3300005841 Unclassified 4718
49 Ga0070717_10008400 3300006028 Bacteria 7711
50 Ga0070717_10050756 3300006028 Bacteria 3411
51 Ga0070715_10402383 3300006163 Unclassified 761
52 Ga0070716_100012863 3300006173 Unclassified 4254
53 Ga0070716_100137380 3300006173 Bacteria 1554
54 Ga0070716_100326278 3300006173 Unclassified 1077
55 Ga0070712_100261322 3300006175 Bacteria 1387
56 Ga0070712_100381050 3300006175 Unclassified 1161
57 Ga0070712_100671353 3300006175 Bacteria 882
58 Ga0070712_101067515 3300006175 Unclassified 700
59 Ga0068865_100728445 3300006881 Unclassified 850
60 Ga0075436_100061812 3300006914 Bacteria 2588
61 Ga0097620_100881071 3300006931 Bacteria 980
62 Ga0099794_10012558 3300007265 Bacteria 3659
63 Ga0099794_10092129 3300007265 Bacteria 1505
64 Ga0099794_10121581 3300007265 Bacteria 1314
65 Ga0099794_10161898 3300007265 Bacteria 1138
66 Ga0099794_10227775 3300007265 Unclassified 958
67 Ga0099795_10289244 3300007788 Unclassified 717
68 Ga0105240_10036350 3300009093 Bacteria 6338
69 Ga0105240_10085086 3300009093 Bacteria 3876
70 Ga0105240_10775478 3300009093 Bacteria 1040
71 Ga0105245_10003881 3300009098 Bacteria 13299
72 Ga0105241_10184414 3300009174 Unclassified 1733
73 Ga0105248_10699415 3300009177 Bacteria 1144
74 Ga0105237_10083353 3300009545 Bacteria 3188
75 Ga0105237_10185557 3300009545 Bacteria 2080
76 Ga0105237_10326179 3300009545 Bacteria 1539
77 Ga0105237_10429412 3300009545 Bacteria 1327
78 Ga0105238_10084581 3300009551 Unclassified 3162
79 Ga0105238_10129908 3300009551 Bacteria 2497
80 Ga0105238_10630529 3300009551 Bacteria 1081
81 Ga0105249_10019370 3300009553 Bacteria 6070
82 Ga0099796_10224380 3300010159 Unclassified 771
83 Ga0099796_10282026 3300010159 Unclassified 699
84 Ga0099796_10292922 3300010159 Bacteria 688
85 Ga0105239_10221158 3300010375 Bacteria 2123
86 Ga0105239_10234913 3300010375 Bacteria 2057
87 Ga0105239_10439702 3300010375 Bacteria 1479
88 Ga0157373_10071326 3300013100 Bacteria 2454
89 Ga0157369_10017712 3300013105 Bacteria 8000
90 Ga0157369_10047711 3300013105 Bacteria 4649
91 Ga0157369_10050565 3300013105 Bacteria 4501
92 Ga0157374_10167195 3300013296 Unclassified 2144
93 Ga0157374_10424382 3300013296 Unclassified 1329
94 Ga0157374_10434739 3300013296 Bacteria 1312
95 Ga0163162_11611550 3300013306 Unclassified 740
96 Ga0157372_10039830 3300013307 Bacteria 5188
97 Ga0157372_10138643 3300013307 Bacteria 2802
98 Ga0163163_10114924 3300014325 Bacteria 2723
99 Ga0224572_1007703 3300024225 Bacteria 1978
100 Ga0224572_1074779 3300024225 Unclassified 625
101 Ga0228598_1005265 3300024227 Bacteria 2712
102 Ga0207656_10138290 3300025321 Bacteria 1146
103 Ga0207692_10259728 3300025898 Unclassified 1044
104 Ga0207692_10508866 3300025898 Bacteria 765
105 Ga0207685_10185597 3300025905 Unclassified 967
106 Ga0207699_10017458 3300025906 Bacteria 3778
107 Ga0207699_10278385 3300025906 Bacteria 1162
108 Ga0207699_10533876 3300025906 Bacteria 849
109 Ga0207684_10573105 3300025910 Bacteria 965
110 Ga0207654_10515478 3300025911 Unclassified 846
111 Ga0207707_10046520 3300025912 Bacteria 3779
112 Ga0207707_10219146 3300025912 Bacteria 1656
113 Ga0207695_10057893 3300025913 Bacteria 4025
114 Ga0207695_10153784 3300025913 Bacteria 2237
115 Ga0207693_10014563 3300025915 Bacteria 6320
116 Ga0207663_10302025 3300025916 Bacteria 1196
117 Ga0207663_10526767 3300025916 Bacteria 921
118 Ga0207660_10492731 3300025917 Bacteria 994
119 Ga0207649_10400059 3300025920 Unclassified 1027
120 Ga0207652_10034427 3300025921 Bacteria 4268
121 Ga0207650_10990189 3300025925 Unclassified 715
122 Ga0207687_10004164 3300025927 Bacteria 9686
123 Ga0207700_10001426 3300025928 Bacteria 13542
124 Ga0207700_10002512 3300025928 Bacteria 10522
125 Ga0207700_10190695 3300025928 Unclassified 1722
126 Ga0207700_10225588 3300025928 Bacteria 1590
127 Ga0207700_10275263 3300025928 Unclassified 1446
128 Ga0207700_10308900 3300025928 Bacteria 1367
129 Ga0207700_10605337 3300025928 Bacteria 975
130 Ga0207664_10025812 3300025929 Bacteria 4432
131 Ga0207665_10000500 3300025939 Bacteria 26563
132 Ga0207665_10013316 3300025939 Bacteria 5405
133 Ga0207665_10159678 3300025939 Bacteria 1621
134 Ga0207665_10274399 3300025939 Bacteria 1253
135 Ga0207665_10812002 3300025939 Unclassified 739
136 Ga0207661_10253899 3300025944 Bacteria 1564
137 Ga0207640_10430675 3300025981 Bacteria 1082
138 Ga0207677_10135534 3300026023 Unclassified 1877
139 Ga0207639_10019967 3300026041 Bacteria 4789
140 Ga0207639_10332438 3300026041 Bacteria 1352
141 Ga0207702_10119496 3300026078 Bacteria 2356
142 Ga0207641_10052086 3300026088 Unclassified 3466
143 Ga0207674_10380097 3300026116 Bacteria 1365
144 Ga0207698_10552039 3300026142 Unclassified 1129
145 Ga0209588_1019645 3300027671 Bacteria 2110
146 Ga0209588_1053894 3300027671 Bacteria 1300
147 Ga0265356_1002569 3300028017 Unclassified 2395
148 Ga0265338_10143010 3300028800 Bacteria 1871
149 Ga0265762_1006664 3300030760 Bacteria 2064
150 Ga0265762_1012944 3300030760 Unclassified 1500
151 Ga0265760_10003939 3300031090 Unclassified 4288
152 Ga0265760_10044438 3300031090 Unclassified 1330
153 Ga0265760_10068487 3300031090 Unclassified 1086
154 Ga0265316_10000602 3300031344 Bacteria 40145
155 Ga0265316_10012052 3300031344 Bacteria 7772
156 Ga0265314_10101395 3300031711 Unclassified 1849
157 Ga0265342_10034456 3300031712 Bacteria 3106
158 Ga0373944_0049011 3300035089 Bacteria 1326
159 Ga0373936_0092187 3300035113 Unclassified 1271
160 Ga0373954_0067175 3300035118 Unclassified 1698
161 Ga0373956_0475311 3300035119 Unclassified 596
162 Ga0373943_0004839 3300035170 Bacteria 6087
163 Ga0373955_0152635 3300035172 Unclassified 1360
164 Ga0373955_0549855 3300035172 Unclassified 706
165 Ga0373924_0024188 3300035410 Bacteria 2391
166 Ga0373935_0113941 3300035692 Bacteria 1798
167 Ga0373935_0423092 3300035692 Unclassified 959
168 Ga0373927_0002053 3300035695 Bacteria 14853
169 Ga0373937_0000027 3300036401 Bacteria 123975
170 Ga0373937_0052347 3300036401 Unclassified 3743
171 Ga0373937_0091351 3300036401 Bacteria 2821
172 Ga0373937_0198038 3300036401 Bacteria 1888
173 Ga0373937_1615378 3300036401 Unclassified 595
174 Ga0373925_1110672 3300037068 Bacteria 650
175 Ga0436365_1312750 3300039437 Bacteria 38305
176 Ga0436361_0232247 3300039447 Unclassified 657
177 Ga0436361_0469866 3300039447 Unclassified 906
178 Ga0436362_0277066 3300039453 Unclassified 1266
179 Ga0495603_0304799 3300046455 Bacteria 915
180 Ga0495651_0064031 3300046462 Unclassified 2810
181 Ga0495580_0007579 3300046472 Bacteria 8705
182 Ga0495664_0393334 3300046477 Unclassified 833
183 Ga0495628_0038886 3300046516 Bacteria 3806
184 Ga0495666_0228807 3300046526 Unclassified 850
185 Ga0495652_0499246 3300046529 Bacteria 844
186 Ga0495645_0014077 3300046543 Bacteria 5669
187 Ga0495645_0160459 3300046543 Bacteria 1555
188 Ga0495659_0140357 3300046664 Unclassified 964
189 Ga0495657_0130334 3300046675 Bacteria 1576
190 Ga0495599_0049246 3300046678 Bacteria 2641
191 Ga0495604_0164706 3300047317 Bacteria 1564
192 Ga0495604_0167684 3300047317 Bacteria 1547
193 Ga0495674_0841379 3300047319 Bacteria 711
194 Ga0495602_0110443 3300048088 Bacteria 2235
195 Ga0496100_0710038 3300048903 Bacteria 785
196 Ga0496102_0088519 3300048905 Bacteria 2863
197 Ga0496102_0122202 3300048905 Bacteria 2432
198 Ga0496104_0015651 3300048907 Bacteria 6878
199 Ga0496105_0703982 3300048908 Unclassified 775
200 Ga0496110_0058462 3300048913 Bacteria 3396
201 Ga0496110_0292386 3300048913 Bacteria 1484
202 Ga0496111_0000546 3300048914 Bacteria 19480
203 Ga0496112_0165719 3300048915 Unclassified 2176
204 Ga0496113_0595170 3300048916 Bacteria 886
205 Ga0496115_0277162 3300048918 Unclassified 1377
206 nmdc:mga0n895_218847_c1 3300050512 Bacteria 1933
207 nmdc:mga08x19_25449_c1 3300050514 Bacteria 3686
208 Ga0495601_0162543 3300053077 Bacteria 1459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031090 Ga0265760_10003939 Ga0265760_100039392 141
2 3300039453 Ga0436362_0277066 Ga0436362_0277066_588_1073 160
3 3300013105 Ga0157369_10050565 Ga0157369_100505654 162
4 3300035089 Ga0373944_0049011 Ga0373944_0049011_793_1281 162
5 3300035119 Ga0373956_0475311 Ga0373956_0475311_94_585 162
6 3300046664 Ga0495659_0140357 Ga0495659_0140357_337_828 162
7 3300035172 Ga0373955_0549855 Ga0373955_0549855_14_505 163
8 3300036401 Ga0373937_1615378 Ga0373937_1615378_23_520 165
9 3300048913 Ga0496110_0058462 Ga0496110_0058462_2710_3207 165
10 3300048914 Ga0496111_0000546 Ga0496111_0000546_4688_5185 165
11 3300024225 Ga0224572_1007703 Ga0224572_10077031 167
12 3300024227 Ga0228598_1005265 Ga0228598_10052652 167
13 3300028017 Ga0265356_1002569 Ga0265356_10025692 167
14 3300030760 Ga0265762_1006664 Ga0265762_10066641 167
15 3300030760 Ga0265762_1012944 Ga0265762_10129442 167
16 3300031090 Ga0265760_10044438 Ga0265760_100444381 167
17 3300050512 nmdc:mga0n895_218847_c1 nmdc:mga0n895_218847_c1_1038_1544 167
18 3300005331 Ga0070670_101191280 Ga0070670_1011912801 168
19 3300005335 Ga0070666_10842388 Ga0070666_108423881 168
20 3300005337 Ga0070682_100146351 Ga0070682_1001463512 168
21 3300005617 Ga0068859_100881213 Ga0068859_1008812132 168
22 3300006931 Ga0097620_100881071 Ga0097620_1008810712 168
23 3300009177 Ga0105248_10699415 Ga0105248_106994152 168
24 3300014325 Ga0163163_10114924 Ga0163163_101149241 168
25 3300025925 Ga0207650_10990189 Ga0207650_109901891 168
26 3300031090 Ga0265760_10068487 Ga0265760_100684872 168
27 3300039437 Ga0436365_1312750 Ga0436365_1312750_14657_15184 168
28 3300046526 Ga0495666_0228807 Ga0495666_0228807_326_838 168
29 3300005367 Ga0070667_100303461 Ga0070667_1003034612 169
30 3300005841 Ga0068863_100035948 Ga0068863_1000359484 169
31 3300006881 Ga0068865_100728445 Ga0068865_1007284452 169
32 3300009553 Ga0105249_10019370 Ga0105249_100193702 169
33 3300026088 Ga0207641_10052086 Ga0207641_100520864 169
34 3300031344 Ga0265316_10000602 Ga0265316_100006022 169
35 3300031344 Ga0265316_10012052 Ga0265316_100120522 169
36 3300031711 Ga0265314_10101395 Ga0265314_101013952 169
37 3300025928 Ga0207700_10190695 Ga0207700_101906951 170
38 3300037068 Ga0373925_1110672 Ga0373925_1110672_49_567 170
39 3300046472 Ga0495580_0007579 Ga0495580_0007579_4354_4872 170
40 3300046529 Ga0495652_0499246 Ga0495652_0499246_115_633 170
41 3300005338 Ga0068868_100288464 Ga0068868_1002884642 171
42 3300005434 Ga0070709_10052902 Ga0070709_100529023 171
43 3300005434 Ga0070709_10085850 Ga0070709_100858501 171
44 3300005435 Ga0070714_100050577 Ga0070714_1000505772 171
45 3300005436 Ga0070713_100011137 Ga0070713_1000111372 171
46 3300005436 Ga0070713_100022401 Ga0070713_1000224016 171
47 3300005436 Ga0070713_100159616 Ga0070713_1001596162 171
48 3300005436 Ga0070713_100928711 Ga0070713_1009287112 171
49 3300005439 Ga0070711_100056027 Ga0070711_1000560273 171
50 3300005439 Ga0070711_100062912 Ga0070711_1000629122 171
51 3300005439 Ga0070711_100322596 Ga0070711_1003225963 171
52 3300005445 Ga0070708_100696870 Ga0070708_1006968701 171
53 3300005458 Ga0070681_10187396 Ga0070681_101873961 171
54 3300005458 Ga0070681_10207766 Ga0070681_102077662 171
55 3300005458 Ga0070681_10764523 Ga0070681_107645231 171
56 3300005467 Ga0070706_100267830 Ga0070706_1002678301 171
57 3300005468 Ga0070707_100953566 Ga0070707_1009535661 171
58 3300005471 Ga0070698_100331708 Ga0070698_1003317082 171
59 3300005518 Ga0070699_100137390 Ga0070699_1001373902 171
60 3300005535 Ga0070684_100085864 Ga0070684_1000858643 171
61 3300005539 Ga0068853_100005588 Ga0068853_1000055885 171
62 3300005539 Ga0068853_100017188 Ga0068853_1000171883 171
63 3300005546 Ga0070696_100331091 Ga0070696_1003310912 171
64 3300005547 Ga0070693_100136234 Ga0070693_1001362341 171
65 3300005547 Ga0070693_100958402 Ga0070693_1009584021 171
66 3300005547 Ga0070693_101115502 Ga0070693_1011155021 171
67 3300005564 Ga0070664_100922597 Ga0070664_1009225971 171
68 3300005578 Ga0068854_100165965 Ga0068854_1001659653 171
69 3300005578 Ga0068854_101208011 Ga0068854_1012080112 171
70 3300005614 Ga0068856_100650618 Ga0068856_1006506182 171
71 3300005616 Ga0068852_100025582 Ga0068852_1000255823 171
72 3300005834 Ga0068851_10019945 Ga0068851_100199452 171
73 3300006028 Ga0070717_10008400 Ga0070717_100084002 171
74 3300006028 Ga0070717_10050756 Ga0070717_100507563 171
75 3300006173 Ga0070716_100137380 Ga0070716_1001373802 171
76 3300006173 Ga0070716_100326278 Ga0070716_1003262782 171
77 3300006175 Ga0070712_100671353 Ga0070712_1006713531 171
78 3300007788 Ga0099795_10289244 Ga0099795_102892441 171
79 3300009093 Ga0105240_10085086 Ga0105240_100850862 171
80 3300009098 Ga0105245_10003881 Ga0105245_100038817 171
81 3300009545 Ga0105237_10185557 Ga0105237_101855573 171
82 3300009545 Ga0105237_10326179 Ga0105237_103261792 171
83 3300009551 Ga0105238_10084581 Ga0105238_100845812 171
84 3300009551 Ga0105238_10129908 Ga0105238_101299082 171
85 3300010159 Ga0099796_10224380 Ga0099796_102243802 171
86 3300010159 Ga0099796_10292922 Ga0099796_102929221 171
87 3300010375 Ga0105239_10221158 Ga0105239_102211582 171
88 3300010375 Ga0105239_10439702 Ga0105239_104397022 171
89 3300013105 Ga0157369_10017712 Ga0157369_100177126 171
90 3300013105 Ga0157369_10047711 Ga0157369_100477114 171
91 3300013296 Ga0157374_10167195 Ga0157374_101671952 171
92 3300013296 Ga0157374_10424382 Ga0157374_104243822 171
93 3300013306 Ga0163162_11611550 Ga0163162_116115501 171
94 3300024225 Ga0224572_1074779 Ga0224572_10747791 171
95 3300025898 Ga0207692_10259728 Ga0207692_102597282 171
96 3300025898 Ga0207692_10508866 Ga0207692_105088661 171
97 3300025906 Ga0207699_10017458 Ga0207699_100174583 171
98 3300025906 Ga0207699_10533876 Ga0207699_105338762 171
99 3300025910 Ga0207684_10573105 Ga0207684_105731052 171
100 3300025911 Ga0207654_10515478 Ga0207654_105154782 171
101 3300025912 Ga0207707_10046520 Ga0207707_100465204 171
102 3300025912 Ga0207707_10219146 Ga0207707_102191462 171
103 3300025913 Ga0207695_10153784 Ga0207695_101537843 171
104 3300025915 Ga0207693_10014563 Ga0207693_100145637 171
105 3300025916 Ga0207663_10526767 Ga0207663_105267672 171
106 3300025927 Ga0207687_10004164 Ga0207687_100041644 171
107 3300025928 Ga0207700_10001426 Ga0207700_100014268 171
108 3300025928 Ga0207700_10002512 Ga0207700_100025124 171
109 3300025928 Ga0207700_10225588 Ga0207700_102255882 171
110 3300025928 Ga0207700_10308900 Ga0207700_103089001 171
111 3300025928 Ga0207700_10605337 Ga0207700_106053372 171
112 3300025929 Ga0207664_10025812 Ga0207664_100258126 171
113 3300025939 Ga0207665_10013316 Ga0207665_100133162 171
114 3300025939 Ga0207665_10159678 Ga0207665_101596781 171
115 3300025939 Ga0207665_10274399 Ga0207665_102743992 171
116 3300025939 Ga0207665_10812002 Ga0207665_108120021 171
117 3300025981 Ga0207640_10430675 Ga0207640_104306752 171
118 3300026023 Ga0207677_10135534 Ga0207677_101355344 171
119 3300026041 Ga0207639_10019967 Ga0207639_100199675 171
120 3300026041 Ga0207639_10332438 Ga0207639_103324381 171
121 3300026142 Ga0207698_10552039 Ga0207698_105520391 171
122 3300027671 Ga0209588_1019645 Ga0209588_10196451 171
123 3300031712 Ga0265342_10034456 Ga0265342_100344565 171
124 3300035410 Ga0373924_0024188 Ga0373924_0024188_745_1260 171
125 3300035692 Ga0373935_0423092 Ga0373935_0423092_377_892 171
126 3300036401 Ga0373937_0000027 Ga0373937_0000027_68811_69326 171
127 3300036401 Ga0373937_0091351 Ga0373937_0091351_2041_2556 171
128 3300046455 Ga0495603_0304799 Ga0495603_0304799_64_594 171
129 3300046462 Ga0495651_0064031 Ga0495651_0064031_2156_2671 171
130 3300046477 Ga0495664_0393334 Ga0495664_0393334_277_810 171
131 3300046543 Ga0495645_0160459 Ga0495645_0160459_246_761 171
132 3300048903 Ga0496100_0710038 Ga0496100_0710038_172_687 171
133 3300048905 Ga0496102_0088519 Ga0496102_0088519_38_553 171
134 3300048905 Ga0496102_0122202 Ga0496102_0122202_1166_1684 171
135 3300048907 Ga0496104_0015651 Ga0496104_0015651_3742_4257 171
136 3300048915 Ga0496112_0165719 Ga0496112_0165719_615_1130 171
137 3300005445 Ga0070708_100003788 Ga0070708_1000037889 172
138 3300006163 Ga0070715_10402383 Ga0070715_104023831 172
139 3300006173 Ga0070716_100012863 Ga0070716_1000128632 172
140 3300006914 Ga0075436_100061812 Ga0075436_1000618122 172
141 3300007265 Ga0099794_10012558 Ga0099794_100125584 172
142 3300007265 Ga0099794_10092129 Ga0099794_100921292 172
143 3300007265 Ga0099794_10121581 Ga0099794_101215811 172
144 3300007265 Ga0099794_10161898 Ga0099794_101618982 172
145 3300007265 Ga0099794_10227775 Ga0099794_102277751 172
146 3300010159 Ga0099796_10282026 Ga0099796_102820261 172
147 3300025939 Ga0207665_10000500 Ga0207665_1000050022 172
148 3300027671 Ga0209588_1053894 Ga0209588_10538942 172
149 3300036401 Ga0373937_0198038 Ga0373937_0198038_1108_1647 172
150 3300047317 Ga0495604_0167684 Ga0495604_0167684_209_730 172
151 3300048088 Ga0495602_0110443 Ga0495602_0110443_1056_1577 172
152 3300050514 nmdc:mga08x19_25449_c1 nmdc:mga08x19_25449_c1_2178_2705 172
153 3300005434 Ga0070709_10192100 Ga0070709_101921003 173
154 3300005458 Ga0070681_10014259 Ga0070681_100142592 173
155 3300005530 Ga0070679_100103428 Ga0070679_1001034283 173
156 3300006175 Ga0070712_100381050 Ga0070712_1003810502 173
157 3300009545 Ga0105237_10083353 Ga0105237_100833532 173
158 3300009551 Ga0105238_10630529 Ga0105238_106305292 173
159 3300013307 Ga0157372_10138643 Ga0157372_101386432 173
160 3300025905 Ga0207685_10185597 Ga0207685_101855972 173
161 3300025917 Ga0207660_10492731 Ga0207660_104927312 173
162 3300025921 Ga0207652_10034427 Ga0207652_100344275 173
163 3300025928 Ga0207700_10275263 Ga0207700_102752632 173
164 3300026116 Ga0207674_10380097 Ga0207674_103800973 173
165 3300035118 Ga0373954_0067175 Ga0373954_0067175_1126_1659 173
166 3300035172 Ga0373955_0152635 Ga0373955_0152635_266_799 173
167 3300035692 Ga0373935_0113941 Ga0373935_0113941_51_605 173
168 3300036401 Ga0373937_0052347 Ga0373937_0052347_1861_2394 173
169 3300039447 Ga0436361_0232247 Ga0436361_0232247_92_625 173
170 3300039447 Ga0436361_0469866 Ga0436361_0469866_282_815 173
171 3300046675 Ga0495657_0130334 Ga0495657_0130334_236_769 173
172 3300047317 Ga0495604_0164706 Ga0495604_0164706_529_1062 173
173 3300048913 Ga0496110_0292386 Ga0496110_0292386_554_1102 173
174 3300048916 Ga0496113_0595170 Ga0496113_0595170_188_718 173
175 3300048918 Ga0496115_0277162 Ga0496115_0277162_456_983 173
176 3300005436 Ga0070713_100262614 Ga0070713_1002626142 174
177 3300035113 Ga0373936_0092187 Ga0373936_0092187_420_980 174
178 3300035170 Ga0373943_0004839 Ga0373943_0004839_2851_3411 174
179 3300035695 Ga0373927_0002053 Ga0373927_0002053_5943_6503 174
180 3300005327 Ga0070658_10306942 Ga0070658_103069422 175
181 3300005435 Ga0070714_100337198 Ga0070714_1003371982 175
182 3300005436 Ga0070713_100029165 Ga0070713_1000291654 175
183 3300005578 Ga0068854_100231919 Ga0068854_1002319191 175
184 3300005834 Ga0068851_10077189 Ga0068851_100771892 175
185 3300006175 Ga0070712_100261322 Ga0070712_1002613222 175
186 3300006175 Ga0070712_101067515 Ga0070712_1010675151 175
187 3300009093 Ga0105240_10036350 Ga0105240_100363502 175
188 3300009093 Ga0105240_10775478 Ga0105240_107754782 175
189 3300009174 Ga0105241_10184414 Ga0105241_101844142 175
190 3300009545 Ga0105237_10429412 Ga0105237_104294121 175
191 3300010375 Ga0105239_10234913 Ga0105239_102349132 175
192 3300013100 Ga0157373_10071326 Ga0157373_100713263 175
193 3300013296 Ga0157374_10434739 Ga0157374_104347391 175
194 3300013307 Ga0157372_10039830 Ga0157372_100398305 175
195 3300025321 Ga0207656_10138290 Ga0207656_101382902 175
196 3300025906 Ga0207699_10278385 Ga0207699_102783852 175
197 3300025913 Ga0207695_10057893 Ga0207695_100578932 175
198 3300025916 Ga0207663_10302025 Ga0207663_103020251 175
199 3300025920 Ga0207649_10400059 Ga0207649_104000592 175
200 3300025944 Ga0207661_10253899 Ga0207661_102538992 175
201 3300026078 Ga0207702_10119496 Ga0207702_101194962 175
202 3300028800 Ga0265338_10143010 Ga0265338_101430103 175
203 3300046516 Ga0495628_0038886 Ga0495628_0038886_504_1043 175
204 3300046543 Ga0495645_0014077 Ga0495645_0014077_3215_3751 175
205 3300046678 Ga0495599_0049246 Ga0495599_0049246_1719_2258 175
206 3300047319 Ga0495674_0841379 Ga0495674_0841379_144_683 175
207 3300048908 Ga0496105_0703982 Ga0496105_0703982_204_743 175
208 3300053077 Ga0495601_0162543 Ga0495601_0162543_650_1189 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07609

DUF1572

Protein of unknown function (DUF1572)

82

181

0.91

PF12867

DinB_2

DinB superfamily

42

171

0.87

PF05163

DinB

DinB family

39

186

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8754 29 172
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8359 32 170
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.8345 32 166
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8324 29 172
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8306 32 170
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8526 29 172 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8223 32 167 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8152 32 167 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.815 29 172 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7922 32 167 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7V1UN80-F1-model_v4 DinB family protein 0.9728 32 174
AF-A0A2V7XQD0-F1-model_v4 Damage-inducible protein DinB 0.9707 32 175
AF-A0A849SD60-F1-model_v4 DinB family protein 0.9689 32 174
AF-A0A539E9R2-F1-model_v4 DinB-like domain-containing protein 0.9662 49 174
AF-A0A2V9X043-F1-model_v4 Damage-inducible protein DinB 0.9647 19 175

Feature Viewer

pLDDT pTM Quality
92.96 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map