F317844

General Info

Members Datasets Scaffolds Average Seq Length
208 145 208 157

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11474417|Ga0157376_114744171
Length 183
Sequence VTYFKSHALKTSCQKIILFLYFAAMITDREKHFMYLAIEESMQGMQAGDVGPFGCVVAKNDEVVGTAHNKVLCTNDPTAHAEVVAIRDACSRMGTFQLDDCEIYCSCEPCPMCFGAIYWARPAKVFYANTKYDAASIGFDDQFIYDHLELPLEERKIPLIAINIPEAMAVFEKWRDNAEKTLY

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 4.81
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1002465 3300005262 Bacteria 15572
2 Ga0070683_100058864 3300005329 Bacteria 3569
3 Ga0070670_100099423 3300005331 Bacteria 2503
4 Ga0068869_100175376 3300005334 Bacteria 1677
5 Ga0068869_100288570 3300005334 Bacteria 1321
6 Ga0070689_100124580 3300005340 Bacteria 2061
7 Ga0070709_10488839 3300005434 Bacteria 933
8 Ga0070709_11502389 3300005434 Bacteria 547
9 Ga0070709_11770411 3300005434 Bacteria 505
10 Ga0070694_100071134 3300005444 Bacteria 2397
11 Ga0070708_100625829 3300005445 Bacteria 1015
12 Ga0070707_100580669 3300005468 Bacteria 1083
13 Ga0070698_100050418 3300005471 Bacteria 4244
14 Ga0070698_100070961 3300005471 Bacteria 3494
15 Ga0070699_100020200 3300005518 Bacteria 5741
16 Ga0070699_100285569 3300005518 Bacteria 1478
17 Ga0070684_100010154 3300005535 Bacteria 7445
18 Ga0070697_100088068 3300005536 Bacteria 2564
19 Ga0070686_100046426 3300005544 Bacteria 2741
20 Ga0070695_100016782 3300005545 Bacteria 4436
21 Ga0070696_100096549 3300005546 Bacteria 2112
22 Ga0070693_100064010 3300005547 Bacteria 2145
23 Ga0068856_101179794 3300005614 Bacteria 782
24 Ga0068859_100488398 3300005617 Bacteria 1327
25 Ga0068864_100905008 3300005618 Bacteria 871
26 Ga0068866_10017003 3300005718 Bacteria 3264
27 Ga0068863_100139569 3300005841 Bacteria 2316
28 Ga0068860_100008908 3300005843 Bacteria 10000
29 Ga0068860_100270493 3300005843 Bacteria 1658
30 Ga0068860_100430425 3300005843 Bacteria 1309
31 Ga0068860_100748544 3300005843 Unclassified 989
32 Ga0068862_100909054 3300005844 Bacteria 866
33 Ga0070716_100149935 3300006173 Bacteria 1498
34 Ga0070716_100287520 3300006173 Bacteria 1137
35 Ga0070716_100844841 3300006173 Bacteria 712
36 Ga0075433_10448594 3300006852 Bacteria 1137
37 Ga0075434_100067817 3300006871 Bacteria 3553
38 Ga0075436_100170283 3300006914 Bacteria 1538
39 Ga0097620_100488387 3300006931 Bacteria 1327
40 Ga0075435_100222835 3300007076 Bacteria 1602
41 Ga0099794_10003170 3300007265 Bacteria 6235
42 Ga0099794_10003889 3300007265 Bacteria 5784
43 Ga0099794_10040857 3300007265 Bacteria 2207
44 Ga0099794_10102148 3300007265 Bacteria 1432
45 Ga0099794_10173952 3300007265 Bacteria 1098
46 Ga0099795_10082014 3300007788 Bacteria 1236
47 Ga0105240_10004240 3300009093 Bacteria 21924
48 Ga0105240_10031672 3300009093 Bacteria 6853
49 Ga0105245_10172404 3300009098 Bacteria 2061
50 Ga0105245_10234110 3300009098 Bacteria 1778
51 Ga0105245_11849693 3300009098 Bacteria 657
52 Ga0105247_10926966 3300009101 Bacteria 675
53 Ga0105237_10027460 3300009545 Bacteria 5811
54 Ga0105237_10392294 3300009545 Bacteria 1393
55 Ga0105238_10058477 3300009551 Bacteria 3864
56 Ga0105249_10142589 3300009553 Bacteria 2299
57 Ga0105249_12253639 3300009553 Bacteria 617
58 Ga0105239_10039687 3300010375 Bacteria 5158
59 Ga0105239_10263127 3300010375 Bacteria 1939
60 Ga0157370_10085009 3300013104 Bacteria 2972
61 Ga0157369_10433608 3300013105 Bacteria 1362
62 Ga0157374_10031654 3300013296 Bacteria 4810
63 Ga0157378_10000044 3300013297 Bacteria 106822
64 Ga0157378_10082305 3300013297 Bacteria 2910
65 Ga0163162_10013979 3300013306 Bacteria 7846
66 Ga0163162_10087629 3300013306 Bacteria 3192
67 Ga0157372_11389882 3300013307 Bacteria 809
68 Ga0163163_10022699 3300014325 Bacteria 5946
69 Ga0163163_10042339 3300014325 Bacteria 4460
70 Ga0157380_10066376 3300014326 Bacteria 2902
71 Ga0157379_10159357 3300014968 Bacteria 2037
72 Ga0157379_11088353 3300014968 Bacteria 765
73 Ga0157376_10000468 3300014969 Bacteria 25990
74 Ga0157376_10029482 3300014969 Unclassified 4371
75 Ga0157376_10241519 3300014969 Bacteria 1683
76 Ga0157376_11474417 3300014969 Bacteria 713
77 Ga0206352_10548950 3300020078 Bacteria 3608
78 Ga0224572_1011028 3300024225 Unclassified 1706
79 Ga0209147_100197 3300025229 Bacteria 67881
80 Ga0207642_10028217 3300025899 Bacteria 2308
81 Ga0207699_10516074 3300025906 Bacteria 864
82 Ga0207699_10635139 3300025906 Bacteria 779
83 Ga0207699_10646397 3300025906 Bacteria 772
84 Ga0207699_10740784 3300025906 Unclassified 721
85 Ga0207695_10024086 3300025913 Bacteria 6859
86 Ga0207646_10511964 3300025922 Bacteria 1081
87 Ga0207694_10091647 3300025924 Bacteria 2399
88 Ga0207706_10147857 3300025933 Bacteria 2067
89 Ga0207686_10458680 3300025934 Bacteria 982
90 Ga0207709_10531047 3300025935 Bacteria 922
91 Ga0207670_10953457 3300025936 Bacteria 720
92 Ga0207665_10000080 3300025939 Bacteria 62639
93 Ga0207665_10133993 3300025939 Bacteria 1761
94 Ga0207689_10131491 3300025942 Bacteria 2060
95 Ga0207689_10637811 3300025942 Bacteria 897
96 Ga0207661_10520060 3300025944 Bacteria 1088
97 Ga0207658_10440335 3300025986 Bacteria 1152
98 Ga0207677_10027086 3300026023 Bacteria 3605
99 Ga0207641_10249575 3300026088 Bacteria 1657
100 Ga0207676_10367783 3300026095 Bacteria 1335
101 Ga0209179_1128337 3300027512 Bacteria 567
102 Ga0209588_1035130 3300027671 Bacteria 1611
103 Ga0209588_1037242 3300027671 Bacteria 1565
104 Ga0209588_1076604 3300027671 Bacteria 1081
105 Ga0209588_1099805 3300027671 Bacteria 934
106 Ga0268265_11039223 3300028380 Bacteria 811
107 Ga0268264_10344840 3300028381 Bacteria 1416
108 Ga0265323_10000441 3300028653 Bacteria 23811
109 Ga0307517_10000737 3300028786 Bacteria 56493
110 Ga0265338_10067826 3300028800 Bacteria 3077
111 Ga0265338_10944242 3300028800 Unclassified 586
112 Ga0307511_10185368 3300030521 Bacteria 1112
113 Ga0265760_10048351 3300031090 Bacteria 1278
114 Ga0265330_10031375 3300031235 Bacteria 2382
115 Ga0265316_10329987 3300031344 Bacteria 1107
116 Ga0265316_10393845 3300031344 Bacteria 998
117 Ga0265342_10009125 3300031712 Bacteria 7027
118 Ga0373954_0026740 3300035118 Bacteria 2646
119 Ga0373955_0052302 3300035172 Unclassified 2228
120 Ga0373931_0396297 3300035691 Bacteria 873
121 Ga0373933_0684910 3300035724 Bacteria 674
122 Ga0373947_0331647 3300035725 Bacteria 1019
123 Ga0373947_0919618 3300035725 Bacteria 597
124 Ga0373937_0065898 3300036401 Bacteria 3335
125 Ga0436365_1479980 3300039437 Bacteria 709
126 Ga0451577_0155306 3300042876 Unclassified 2059
127 Ga0451577_1227962 3300042876 Bacteria 668
128 Ga0453683_0003295 3300044673 Bacteria 11969
129 Ga0453683_0007885 3300044673 Bacteria 7180
130 Ga0453683_0322762 3300044673 Bacteria 989
131 Ga0453684_0000912 3300044712 Bacteria 98180
132 Ga0453684_0009908 3300044712 Bacteria 16448
133 Ga0453684_0189277 3300044712 Unclassified 2408
134 Ga0451576_0042302 3300045051 Bacteria 4810
135 Ga0451576_0153468 3300045051 Bacteria 2402
136 Ga0451576_0430238 3300045051 Unclassified 1385
137 Ga0451576_1558215 3300045051 Bacteria 686
138 Ga0466967_0394115 3300045976 Bacteria 1346
139 Ga0495592_0128935 3300046454 Unclassified 1771
140 Ga0495603_0008590 3300046455 Bacteria 6173
141 Ga0495629_0065360 3300046459 Bacteria 2539
142 Ga0495641_0098362 3300046461 Bacteria 1306
143 Ga0495653_0549653 3300046463 Unclassified 715
144 Ga0495580_0095110 3300046472 Bacteria 2072
145 Ga0495580_0535189 3300046472 Bacteria 779
146 Ga0495582_0320668 3300046473 Bacteria 891
147 Ga0495639_0137314 3300046475 Bacteria 1173
148 Ga0495662_0113564 3300046476 Bacteria 1328
149 Ga0495664_0043931 3300046477 Unclassified 2648
150 Ga0495618_0017242 3300046514 Bacteria 4425
151 Ga0495618_0656365 3300046514 Bacteria 620
152 Ga0495628_0552387 3300046516 Bacteria 827
153 Ga0495630_0122214 3300046517 Bacteria 1975
154 Ga0495666_0014536 3300046526 Bacteria 3920
155 Ga0495652_0771809 3300046529 Bacteria 642
156 Ga0495665_0049105 3300046531 Bacteria 2237
157 Ga0495640_0076782 3300046533 Bacteria 2228
158 Ga0495640_0092416 3300046533 Bacteria 1995
159 Ga0495645_0027284 3300046543 Bacteria 4147
160 Ga0495645_0054698 3300046543 Bacteria 2899
161 Ga0495645_0714305 3300046543 Bacteria 607
162 Ga0495622_0094173 3300046557 Bacteria 1375
163 Ga0495667_0019665 3300046559 Bacteria 4556
164 Ga0495634_0184634 3300046642 Unclassified 1304
165 Ga0495635_0052258 3300046663 Bacteria 2815
166 Ga0495635_0330909 3300046663 Unclassified 1018
167 Ga0495635_0712586 3300046663 Bacteria 650
168 Ga0495623_0162882 3300046679 Bacteria 1309
169 Ga0495623_0451981 3300046679 Unclassified 684
170 Ga0495658_0081925 3300046683 Bacteria 1895
171 Ga0495613_0068106 3300046689 Unclassified 2597
172 Ga0495613_0084721 3300046689 Bacteria 2301
173 Ga0495624_0283121 3300046690 Bacteria 1001
174 Ga0495600_0353736 3300046809 Bacteria 920
175 Ga0495604_0025836 3300047317 Bacteria 4677
176 Ga0495604_0253659 3300047317 Bacteria 1198
177 Ga0495604_0283988 3300047317 Bacteria 1117
178 Ga0495636_0042859 3300047318 Unclassified 1881
179 Ga0495674_0419561 3300047319 Bacteria 1078
180 Ga0495680_0020496 3300047322 Bacteria 5562
181 Ga0495680_0033031 3300047322 Bacteria 4194
182 Ga0495680_0370698 3300047322 Bacteria 993
183 Ga0495675_0012844 3300047444 Bacteria 5277
184 Ga0495684_0000267 3300047471 Bacteria 41592
185 Ga0495684_0149088 3300047471 Bacteria 1750
186 Ga0495593_0040741 3300047673 Bacteria 2500
187 Ga0495602_0038012 3300048088 Bacteria 4457
188 Ga0495602_0181455 3300048088 Unclassified 1623
189 Ga0495614_0024906 3300048089 Bacteria 2582
190 Ga0496101_0144187 3300048904 Bacteria 1818
191 Ga0496102_0000933 3300048905 Bacteria 27557
192 Ga0496103_0060297 3300048906 Bacteria 2358
193 Ga0496104_0730623 3300048907 Bacteria 897
194 Ga0496105_0547056 3300048908 Bacteria 904
195 Ga0496106_0008520 3300048909 Bacteria 7583
196 Ga0496112_0100253 3300048915 Bacteria 2866
197 Ga0496114_0078686 3300048917 Bacteria 2782
198 Ga0496114_0090750 3300048917 Bacteria 2594
199 Ga0496115_0034324 3300048918 Bacteria 4009
200 Ga0501034_0090965 3300049571 Bacteria 3049
201 nmdc:mga0k408_109799_c1 3300050493 Bacteria 1630
202 nmdc:mga0n895_2091472_c1 3300050512 Bacteria 523
203 nmdc:mga0n895_93901_c1 3300050512 Bacteria 3003
204 nmdc:mga0rr50_302138_c1 3300050513 Bacteria 1339
205 nmdc:mga08x19_153929_c1 3300050514 Bacteria 1558
206 nmdc:mga0a205_225237_c1 3300050515 Bacteria 1760
207 Ga0495601_0085552 3300053077 Bacteria 2026
208 Ga0495619_0049059 3300053085 Bacteria 2783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100058864 Ga0070683_1000588643 154
2 3300005334 Ga0068869_100175376 Ga0068869_1001753761 154
3 3300005434 Ga0070709_10488839 Ga0070709_104888392 154
4 3300005434 Ga0070709_11770411 Ga0070709_117704111 154
5 3300005444 Ga0070694_100071134 Ga0070694_1000711342 154
6 3300005471 Ga0070698_100070961 Ga0070698_1000709613 154
7 3300005535 Ga0070684_100010154 Ga0070684_10001015410 154
8 3300005544 Ga0070686_100046426 Ga0070686_1000464262 154
9 3300005546 Ga0070696_100096549 Ga0070696_1000965493 154
10 3300005614 Ga0068856_101179794 Ga0068856_1011797942 154
11 3300005617 Ga0068859_100488398 Ga0068859_1004883982 154
12 3300005718 Ga0068866_10017003 Ga0068866_100170033 154
13 3300005841 Ga0068863_100139569 Ga0068863_1001395692 154
14 3300005843 Ga0068860_100008908 Ga0068860_10000890810 154
15 3300005843 Ga0068860_100430425 Ga0068860_1004304252 154
16 3300005843 Ga0068860_100748544 Ga0068860_1007485442 154
17 3300006173 Ga0070716_100149935 Ga0070716_1001499353 154
18 3300006173 Ga0070716_100287520 Ga0070716_1002875202 154
19 3300006173 Ga0070716_100844841 Ga0070716_1008448411 154
20 3300006871 Ga0075434_100067817 Ga0075434_1000678173 154
21 3300006914 Ga0075436_100170283 Ga0075436_1001702832 154
22 3300006931 Ga0097620_100488387 Ga0097620_1004883872 154
23 3300007076 Ga0075435_100222835 Ga0075435_1002228352 154
24 3300009093 Ga0105240_10004240 Ga0105240_100042405 154
25 3300009098 Ga0105245_10234110 Ga0105245_102341103 154
26 3300009545 Ga0105237_10392294 Ga0105237_103922942 154
27 3300009551 Ga0105238_10058477 Ga0105238_100584773 154
28 3300009553 Ga0105249_12253639 Ga0105249_122536391 154
29 3300010375 Ga0105239_10263127 Ga0105239_102631271 154
30 3300013105 Ga0157369_10433608 Ga0157369_104336082 154
31 3300013297 Ga0157378_10000044 Ga0157378_1000004473 154
32 3300013306 Ga0163162_10087629 Ga0163162_100876292 154
33 3300014325 Ga0163163_10022699 Ga0163163_100226998 154
34 3300014968 Ga0157379_10159357 Ga0157379_101593572 154
35 3300014968 Ga0157379_11088353 Ga0157379_110883531 154
36 3300020078 Ga0206352_10548950 Ga0206352_105489503 154
37 3300025899 Ga0207642_10028217 Ga0207642_100282172 154
38 3300025906 Ga0207699_10646397 Ga0207699_106463971 154
39 3300025906 Ga0207699_10740784 Ga0207699_107407841 154
40 3300025913 Ga0207695_10024086 Ga0207695_100240865 154
41 3300025924 Ga0207694_10091647 Ga0207694_100916473 154
42 3300025933 Ga0207706_10147857 Ga0207706_101478571 154
43 3300025935 Ga0207709_10531047 Ga0207709_105310472 154
44 3300025939 Ga0207665_10133993 Ga0207665_101339932 154
45 3300025942 Ga0207689_10131491 Ga0207689_101314912 154
46 3300025942 Ga0207689_10637811 Ga0207689_106378112 154
47 3300025944 Ga0207661_10520060 Ga0207661_105200601 154
48 3300028380 Ga0268265_11039223 Ga0268265_110392232 154
49 3300028381 Ga0268264_10344840 Ga0268264_103448402 154
50 3300028653 Ga0265323_10000441 Ga0265323_100004415 154
51 3300028800 Ga0265338_10944242 Ga0265338_109442421 154
52 3300030521 Ga0307511_10185368 Ga0307511_101853682 154
53 3300031344 Ga0265316_10329987 Ga0265316_103299872 154
54 3300031344 Ga0265316_10393845 Ga0265316_103938452 154
55 3300035691 Ga0373931_0396297 Ga0373931_0396297_362_826 154
56 3300039437 Ga0436365_1479980 Ga0436365_1479980_149_619 154
57 3300045051 Ga0451576_0153468 Ga0451576_0153468_601_1065 154
58 3300045051 Ga0451576_1558215 Ga0451576_1558215_92_556 154
59 3300045976 Ga0466967_0394115 Ga0466967_0394115_381_845 154
60 3300046454 Ga0495592_0128935 Ga0495592_0128935_1138_1602 154
61 3300046463 Ga0495653_0549653 Ga0495653_0549653_228_692 154
62 3300046472 Ga0495580_0535189 Ga0495580_0535189_156_620 154
63 3300046477 Ga0495664_0043931 Ga0495664_0043931_649_1113 154
64 3300046514 Ga0495618_0656365 Ga0495618_0656365_127_591 154
65 3300046516 Ga0495628_0552387 Ga0495628_0552387_216_680 154
66 3300046529 Ga0495652_0771809 Ga0495652_0771809_22_486 154
67 3300046533 Ga0495640_0092416 Ga0495640_0092416_34_498 154
68 3300046543 Ga0495645_0027284 Ga0495645_0027284_707_1171 154
69 3300046543 Ga0495645_0054698 Ga0495645_0054698_1845_2309 154
70 3300046559 Ga0495667_0019665 Ga0495667_0019665_3641_4105 154
71 3300046642 Ga0495634_0184634 Ga0495634_0184634_567_1031 154
72 3300046663 Ga0495635_0330909 Ga0495635_0330909_32_496 154
73 3300046663 Ga0495635_0712586 Ga0495635_0712586_107_571 154
74 3300046679 Ga0495623_0162882 Ga0495623_0162882_431_895 154
75 3300046689 Ga0495613_0068106 Ga0495613_0068106_1706_2170 154
76 3300046689 Ga0495613_0084721 Ga0495613_0084721_248_712 154
77 3300047317 Ga0495604_0025836 Ga0495604_0025836_3594_4058 154
78 3300047318 Ga0495636_0042859 Ga0495636_0042859_62_526 154
79 3300047319 Ga0495674_0419561 Ga0495674_0419561_270_734 154
80 3300047322 Ga0495680_0033031 Ga0495680_0033031_3533_3997 154
81 3300047444 Ga0495675_0012844 Ga0495675_0012844_356_820 154
82 3300047471 Ga0495684_0000267 Ga0495684_0000267_25919_26383 154
83 3300047471 Ga0495684_0149088 Ga0495684_0149088_280_744 154
84 3300048088 Ga0495602_0038012 Ga0495602_0038012_1310_1774 154
85 3300048088 Ga0495602_0181455 Ga0495602_0181455_61_525 154
86 3300048905 Ga0496102_0000933 Ga0496102_0000933_19738_20202 154
87 3300048906 Ga0496103_0060297 Ga0496103_0060297_1867_2331 154
88 3300048909 Ga0496106_0008520 Ga0496106_0008520_3863_4327 154
89 3300050512 nmdc:mga0n895_2091472_c1 nmdc:mga0n895_2091472_c1_24_488 154
90 3300050513 nmdc:mga0rr50_302138_c1 nmdc:mga0rr50_302138_c1_368_856 154
91 3300050514 nmdc:mga08x19_153929_c1 nmdc:mga08x19_153929_c1_510_998 154
92 3300005262 Ga0065165_1002465 Ga0065165_10024657 155
93 3300005331 Ga0070670_100099423 Ga0070670_1000994231 155
94 3300005334 Ga0068869_100288570 Ga0068869_1002885701 155
95 3300005340 Ga0070689_100124580 Ga0070689_1001245801 155
96 3300005434 Ga0070709_11502389 Ga0070709_115023891 155
97 3300005445 Ga0070708_100625829 Ga0070708_1006258292 155
98 3300005468 Ga0070707_100580669 Ga0070707_1005806691 155
99 3300005471 Ga0070698_100050418 Ga0070698_1000504182 155
100 3300005518 Ga0070699_100020200 Ga0070699_1000202004 155
101 3300005518 Ga0070699_100285569 Ga0070699_1002855692 155
102 3300005536 Ga0070697_100088068 Ga0070697_1000880681 155
103 3300005545 Ga0070695_100016782 Ga0070695_1000167822 155
104 3300005547 Ga0070693_100064010 Ga0070693_1000640102 155
105 3300005618 Ga0068864_100905008 Ga0068864_1009050081 155
106 3300005843 Ga0068860_100270493 Ga0068860_1002704931 155
107 3300005844 Ga0068862_100909054 Ga0068862_1009090541 155
108 3300006852 Ga0075433_10448594 Ga0075433_104485942 155
109 3300007265 Ga0099794_10003170 Ga0099794_100031707 155
110 3300007265 Ga0099794_10003889 Ga0099794_100038892 155
111 3300007265 Ga0099794_10040857 Ga0099794_100408571 155
112 3300007265 Ga0099794_10102148 Ga0099794_101021482 155
113 3300007265 Ga0099794_10173952 Ga0099794_101739522 155
114 3300007788 Ga0099795_10082014 Ga0099795_100820141 155
115 3300009093 Ga0105240_10031672 Ga0105240_100316727 155
116 3300009098 Ga0105245_10172404 Ga0105245_101724043 155
117 3300009098 Ga0105245_11849693 Ga0105245_118496931 155
118 3300009101 Ga0105247_10926966 Ga0105247_109269662 155
119 3300009545 Ga0105237_10027460 Ga0105237_100274603 155
120 3300009553 Ga0105249_10142589 Ga0105249_101425894 155
121 3300010375 Ga0105239_10039687 Ga0105239_100396873 155
122 3300013104 Ga0157370_10085009 Ga0157370_100850092 155
123 3300013296 Ga0157374_10031654 Ga0157374_100316542 155
124 3300013297 Ga0157378_10082305 Ga0157378_100823053 155
125 3300013306 Ga0163162_10013979 Ga0163162_100139798 155
126 3300013307 Ga0157372_11389882 Ga0157372_113898822 155
127 3300014325 Ga0163163_10042339 Ga0163163_100423392 155
128 3300014326 Ga0157380_10066376 Ga0157380_100663764 155
129 3300014969 Ga0157376_10000468 Ga0157376_1000046816 155
130 3300014969 Ga0157376_10029482 Ga0157376_100294824 155
131 3300014969 Ga0157376_10241519 Ga0157376_102415192 155
132 3300014969 Ga0157376_11474417 Ga0157376_114744171 155
133 3300024225 Ga0224572_1011028 Ga0224572_10110283 155
134 3300025229 Ga0209147_100197 Ga0209147_10019743 155
135 3300025906 Ga0207699_10516074 Ga0207699_105160741 155
136 3300025906 Ga0207699_10635139 Ga0207699_106351392 155
137 3300025922 Ga0207646_10511964 Ga0207646_105119642 155
138 3300025934 Ga0207686_10458680 Ga0207686_104586802 155
139 3300025936 Ga0207670_10953457 Ga0207670_109534571 155
140 3300025939 Ga0207665_10000080 Ga0207665_1000008027 155
141 3300025986 Ga0207658_10440335 Ga0207658_104403352 155
142 3300026023 Ga0207677_10027086 Ga0207677_100270862 155
143 3300026088 Ga0207641_10249575 Ga0207641_102495753 155
144 3300026095 Ga0207676_10367783 Ga0207676_103677832 155
145 3300027512 Ga0209179_1128337 Ga0209179_11283371 155
146 3300027671 Ga0209588_1035130 Ga0209588_10351301 155
147 3300027671 Ga0209588_1037242 Ga0209588_10372423 155
148 3300027671 Ga0209588_1076604 Ga0209588_10766042 155
149 3300027671 Ga0209588_1099805 Ga0209588_10998052 155
150 3300028786 Ga0307517_10000737 Ga0307517_1000073725 155
151 3300028800 Ga0265338_10067826 Ga0265338_100678263 155
152 3300031090 Ga0265760_10048351 Ga0265760_100483512 155
153 3300031235 Ga0265330_10031375 Ga0265330_100313752 155
154 3300031712 Ga0265342_10009125 Ga0265342_100091259 155
155 3300035118 Ga0373954_0026740 Ga0373954_0026740_456_938 155
156 3300035172 Ga0373955_0052302 Ga0373955_0052302_1093_1575 155
157 3300035724 Ga0373933_0684910 Ga0373933_0684910_119_658 155
158 3300035725 Ga0373947_0331647 Ga0373947_0331647_460_927 155
159 3300035725 Ga0373947_0919618 Ga0373947_0919618_64_546 155
160 3300036401 Ga0373937_0065898 Ga0373937_0065898_1528_2067 155
161 3300042876 Ga0451577_0155306 Ga0451577_0155306_1238_1708 155
162 3300042876 Ga0451577_1227962 Ga0451577_1227962_115_582 155
163 3300044673 Ga0453683_0003295 Ga0453683_0003295_2838_3314 155
164 3300044673 Ga0453683_0007885 Ga0453683_0007885_1551_2027 155
165 3300044673 Ga0453683_0322762 Ga0453683_0322762_473_940 155
166 3300044712 Ga0453684_0000912 Ga0453684_0000912_22851_23327 155
167 3300044712 Ga0453684_0009908 Ga0453684_0009908_5841_6317 155
168 3300044712 Ga0453684_0189277 Ga0453684_0189277_1240_1710 155
169 3300045051 Ga0451576_0042302 Ga0451576_0042302_240_716 155
170 3300045051 Ga0451576_0430238 Ga0451576_0430238_437_913 155
171 3300046455 Ga0495603_0008590 Ga0495603_0008590_3528_3995 155
172 3300046459 Ga0495629_0065360 Ga0495629_0065360_1195_1662 155
173 3300046461 Ga0495641_0098362 Ga0495641_0098362_594_1061 155
174 3300046472 Ga0495580_0095110 Ga0495580_0095110_162_629 155
175 3300046473 Ga0495582_0320668 Ga0495582_0320668_239_706 155
176 3300046475 Ga0495639_0137314 Ga0495639_0137314_537_1004 155
177 3300046476 Ga0495662_0113564 Ga0495662_0113564_565_1032 155
178 3300046514 Ga0495618_0017242 Ga0495618_0017242_328_867 155
179 3300046517 Ga0495630_0122214 Ga0495630_0122214_1485_1952 155
180 3300046526 Ga0495666_0014536 Ga0495666_0014536_3292_3759 155
181 3300046531 Ga0495665_0049105 Ga0495665_0049105_1258_1725 155
182 3300046533 Ga0495640_0076782 Ga0495640_0076782_982_1449 155
183 3300046543 Ga0495645_0714305 Ga0495645_0714305_54_593 155
184 3300046557 Ga0495622_0094173 Ga0495622_0094173_141_608 155
185 3300046663 Ga0495635_0052258 Ga0495635_0052258_1515_1982 155
186 3300046679 Ga0495623_0451981 Ga0495623_0451981_175_657 155
187 3300046683 Ga0495658_0081925 Ga0495658_0081925_298_765 155
188 3300046690 Ga0495624_0283121 Ga0495624_0283121_238_705 155
189 3300046809 Ga0495600_0353736 Ga0495600_0353736_75_614 155
190 3300047317 Ga0495604_0253659 Ga0495604_0253659_201_740 155
191 3300047317 Ga0495604_0283988 Ga0495604_0283988_354_920 155
192 3300047322 Ga0495680_0020496 Ga0495680_0020496_872_1339 155
193 3300047322 Ga0495680_0370698 Ga0495680_0370698_231_770 155
194 3300047673 Ga0495593_0040741 Ga0495593_0040741_1161_1628 155
195 3300048089 Ga0495614_0024906 Ga0495614_0024906_487_954 155
196 3300048904 Ga0496101_0144187 Ga0496101_0144187_1300_1767 155
197 3300048907 Ga0496104_0730623 Ga0496104_0730623_101_577 155
198 3300048908 Ga0496105_0547056 Ga0496105_0547056_415_891 155
199 3300048915 Ga0496112_0100253 Ga0496112_0100253_1005_1472 155
200 3300048917 Ga0496114_0078686 Ga0496114_0078686_385_861 155
201 3300048917 Ga0496114_0090750 Ga0496114_0090750_1178_1645 155
202 3300048918 Ga0496115_0034324 Ga0496115_0034324_2414_2881 155
203 3300049571 Ga0501034_0090965 Ga0501034_0090965_993_1472 155
204 3300050493 nmdc:mga0k408_109799_c1 nmdc:mga0k408_109799_c1_755_1228 155
205 3300050512 nmdc:mga0n895_93901_c1 nmdc:mga0n895_93901_c1_1466_1933 155
206 3300050515 nmdc:mga0a205_225237_c1 nmdc:mga0a205_225237_c1_727_1194 155
207 3300053077 Ga0495601_0085552 Ga0495601_0085552_114_653 155
208 3300053085 Ga0495619_0049059 Ga0495619_0049059_37_504 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

27

129

0.95

PF14437

MafB19-deam

MafB19-like deaminase

28

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9842 2 99
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9775 2 99
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.975 1 102
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9715 1 155
2nx8-assembly1.cif.gz_A-2 the crystal structure of the trna-specific adenosine deaminase from streptococcus pyogenes 0.9681 2 102
ID Description Score Start End Superfamily
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9828 3 109 3.40.140.10
af_A0A0R0IBM9_22_185_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9799 4 113 3.40.140.10
af_F8W4Y0_130_228_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9751 25 38 2.60.40.10
1tiyB00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9708 1 147 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9681 2 102 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7W1FG80-F1-model_v4 Nucleoside deaminase 0.9947 2 107 GO:0006152
GO:0008270
GO:0047974
AF-A0A060BSU2-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9946 25 102 GO:0002100
GO:0008270
GO:0052717
AF-A0A2H9LF16-F1-model_v4 Nucleoside deaminase 0.9913 5 100 GO:0006152
GO:0008270
GO:0047974
AF-A0A7Y4TNI9-F1-model_v4 Nucleoside deaminase 0.9896 4 90 GO:0006152
GO:0008270
GO:0047974
AF-A0A257RV18-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9882 5 99 GO:0002100
GO:0008270
GO:0052717

Feature Viewer

pLDDT pTM Quality
95.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map