F317843

General Info

Members Datasets Scaffolds Average Seq Length
208 176 416 229

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10790228|Ga0157376_107902281
Length 267
Sequence MAPPLTGGAFVRIVLGTGAHLPCRPVCHLSRCAVGWNRWGIAEVPAAMTTIGLIGSGNIGSTVARLAIAACHDVVLSNSRGPQTLQELASELGPKARAATPTDAAAAGDIVVVTVPLRAYRDVPAAPLAGKVVIDTNNYYPERDGVFDELEDGSSTTGELLQKHLPEAHVVKGFNNIWFEHLRSLARPAGSADRSALPIAGDDATAKRAVIKFFDSLGFDTVDAGPLAENWRTQRDTPVYVAPYGPYGVLPGTPASAQVVREALAAA

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
112 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
113 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 2643221711 Terrabacter sp. Root85 Isolate Unclassified
167 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
168 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
169 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
170 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
171 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
172 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
173 2855683550 Micromonospora sp. RP3T Isolate Unclassified
174 2862574272 Streptomyces sp. AcE210 Isolate Nodule
175 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
176 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 4.33
Nodule 0.48
Rhizoplane 7.69
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10790228 3300014969 Bacteria 961
2 JGI25406J46586_10002653 3300003203 Bacteria 8430
3 Ga0055527_1000005 3300003760 Bacteria 504776
4 Ga0055542_1000006 3300003762 Bacteria 504776
5 Ga0055529_1000013 3300003763 Bacteria 373267
6 Ga0070683_100000701 3300005329 Bacteria 24341
7 Ga0070670_100101516 3300005331 Bacteria 2477
8 Ga0068869_100006636 3300005334 Bacteria 7347
9 Ga0070682_100058140 3300005337 Bacteria 2438
10 Ga0068868_100959160 3300005338 Bacteria 780
11 Ga0070661_100055494 3300005344 Bacteria 2901
12 Ga0070661_100123865 3300005344 Bacteria 1938
13 Ga0070668_100000331 3300005347 Bacteria 31122
14 Ga0070675_100000555 3300005354 Bacteria 25670
15 Ga0070675_100642165 3300005354 Bacteria 964
16 Ga0070671_100531808 3300005355 Bacteria 1013
17 Ga0070674_100058881 3300005356 Bacteria 2672
18 Ga0070659_100109534 3300005366 Bacteria 2229
19 Ga0070667_100028654 3300005367 Bacteria 4637
20 Ga0070709_10009402 3300005434 Bacteria 5392
21 Ga0070714_100027191 3300005435 Bacteria 4734
22 Ga0070713_100378371 3300005436 Bacteria 1319
23 Ga0070713_100504021 3300005436 Bacteria 1142
24 Ga0070710_10002570 3300005437 Bacteria 8618
25 Ga0070700_100002952 3300005441 Bacteria 8730
26 Ga0070663_100004059 3300005455 Bacteria 8548
27 Ga0070707_100049490 3300005468 Bacteria 4029
28 Ga0070699_100097840 3300005518 Bacteria 2571
29 Ga0070684_100001133 3300005535 Bacteria 19127
30 Ga0070697_100010129 3300005536 Bacteria 7355
31 Ga0070672_100019545 3300005543 Bacteria 4918
32 Ga0070664_100013204 3300005564 Bacteria 6725
33 Ga0068857_100002994 3300005577 Bacteria 13934
34 Ga0068852_100870809 3300005616 Bacteria 917
35 Ga0068859_100490374 3300005617 Bacteria 1324
36 Ga0068861_100108448 3300005719 Bacteria 2221
37 Ga0068863_100501688 3300005841 Bacteria 1195
38 Ga0068858_100012460 3300005842 Bacteria 8019
39 Ga0068860_100021945 3300005843 Bacteria 6178
40 Ga0068860_100808473 3300005843 Bacteria 951
41 Ga0068862_100007306 3300005844 Bacteria 9171
42 Ga0068862_100087427 3300005844 Bacteria 2711
43 Ga0081455_10071073 3300005937 Bacteria 2886
44 Ga0081539_10006212 3300005985 Bacteria 11594
45 Ga0070716_100416750 3300006173 Bacteria 970
46 Ga0097621_100873731 3300006237 Bacteria 836
47 Ga0075434_100023461 3300006871 Bacteria 6014
48 Ga0068865_100677241 3300006881 Bacteria 879
49 Ga0111539_10004523 3300009094 Bacteria 18186
50 Ga0105245_10005301 3300009098 Bacteria 11327
51 Ga0114129_10381516 3300009147 Bacteria 1861
52 Ga0114129_10719952 3300009147 Bacteria 1281
53 Ga0105243_10891029 3300009148 Bacteria 884
54 Ga0105238_10120288 3300009551 Bacteria 2605
55 Ga0105249_10093676 3300009553 Bacteria 2814
56 Ga0105239_10044044 3300010375 Bacteria 4893
57 Ga0157378_10773271 3300013297 Bacteria 984
58 Ga0163163_10544344 3300014325 Bacteria 1223
59 Ga0163163_10945803 3300014325 Bacteria 925
60 Ga0157377_10001573 3300014745 Bacteria 9921
61 Ga0209672_100003 3300025228 Bacteria 1560476
62 Ga0209147_100744 3300025229 Bacteria 16112
63 Ga0209148_1000004 3300025254 Bacteria 1844481
64 Ga0209455_1000022 3300025272 Bacteria 688910
65 Ga0207688_10010466 3300025901 Bacteria 5048
66 Ga0207645_10257525 3300025907 Bacteria 1155
67 Ga0207693_10239191 3300025915 Bacteria 1425
68 Ga0207649_10036165 3300025920 Bacteria 2972
69 Ga0207650_10032993 3300025925 Bacteria 3747
70 Ga0207659_10090486 3300025926 Bacteria 2284
71 Ga0207687_10040640 3300025927 Bacteria 3189
72 Ga0207700_10134054 3300025928 Bacteria 2026
73 Ga0207700_10259716 3300025928 Bacteria 1487
74 Ga0207664_10194688 3300025929 Bacteria 1747
75 Ga0207664_10558397 3300025929 Bacteria 1027
76 Ga0207690_10024242 3300025932 Bacteria 3798
77 Ga0207709_10373037 3300025935 Bacteria 1083
78 Ga0207669_10062937 3300025937 Bacteria 2288
79 Ga0207691_10014012 3300025940 Bacteria 7648
80 Ga0207691_10166271 3300025940 Bacteria 1933
81 Ga0207689_10000906 3300025942 Bacteria 28442
82 Ga0207689_10197424 3300025942 Bacteria 1661
83 Ga0207661_10023911 3300025944 Bacteria 4623
84 Ga0207679_10086163 3300025945 Bacteria 2415
85 Ga0207679_10548868 3300025945 Bacteria 1037
86 Ga0207668_10164522 3300025972 Bacteria 1732
87 Ga0207658_10015781 3300025986 Bacteria 5185
88 Ga0207658_10035574 3300025986 Bacteria 3568
89 Ga0207703_10028145 3300026035 Bacteria 4427
90 Ga0207678_10005907 3300026067 Bacteria 10905
91 Ga0207708_10000756 3300026075 Bacteria 24234
92 Ga0207641_10487520 3300026088 Bacteria 1195
93 Ga0207674_10032510 3300026116 Bacteria 5472
94 Ga0207698_10022460 3300026142 Bacteria 4385
95 Ga0207428_10004524 3300027907 Bacteria 13188
96 Ga0268265_10059926 3300028380 Bacteria 2915
97 Ga0268265_10077421 3300028380 Bacteria 2612
98 Ga0268265_10094093 3300028380 Bacteria 2402
99 Ga0268264_10023840 3300028381 Bacteria 4992
100 Ga0307515_10000205 3300028794 Bacteria 144874
101 Ga0307515_10033707 3300028794 Bacteria 8416
102 Ga0265330_10012066 3300031235 Bacteria 4040
103 Ga0265328_10051995 3300031239 Bacteria 1504
104 Ga0265329_10000313 3300031242 Bacteria 25790
105 Ga0265339_10048459 3300031249 Bacteria 2329
106 Ga0265316_10002561 3300031344 Bacteria 18786
107 Ga0307513_10047745 3300031456 Bacteria 4654
108 Ga0307513_10131805 3300031456 Bacteria 2444
109 Ga0307509_10400777 3300031507 Bacteria 1079
110 Ga0265314_10241422 3300031711 Bacteria 1042
111 Ga0265342_10000363 3300031712 Bacteria 50032
112 Ga0307516_10000409 3300031730 Bacteria 56212
113 Ga0307516_10010365 3300031730 Bacteria 10254
114 Ga0307516_10201064 3300031730 Bacteria 1712
115 Ga0307405_10140040 3300031731 Bacteria 1685
116 Ga0307410_10005516 3300031852 Bacteria 6705
117 Ga0307407_10007245 3300031903 Bacteria 5011
118 Ga0307409_100022836 3300031995 Bacteria 4319
119 Ga0307416_100167499 3300032002 Bacteria 2040
120 Ga0307411_10191060 3300032005 Bacteria 1564
121 Ga0307415_100003271 3300032126 Bacteria 8236
122 Ga0307415_100276231 3300032126 Bacteria 1379
123 Ga0373946_0032528 3300035171 Bacteria 2095
124 Ga0373935_0025520 3300035692 Bacteria 3642
125 Ga0373927_0117756 3300035695 Bacteria 1733
126 Ga0373933_0128487 3300035724 Bacteria 1592
127 Ga0373937_0858010 3300036401 Bacteria 856
128 Ga0373925_0194096 3300037068 Bacteria 1612
129 Ga0373925_0258742 3300037068 Bacteria 1398
130 Ga0436364_0020241 3300037853 Bacteria 2736
131 Ga0436363_1483276 3300039450 Unclassified 723
132 Ga0451789_0854181 3300041443 Bacteria 4672
133 Ga0451791_0456307 3300041451 Bacteria 2071
134 Ga0451797_1236517 3300041453 Bacteria 2030
135 Ga0451800_1437463 3300041459 Bacteria 1192
136 Ga0451833_1369568 3300041491 Bacteria 3656
137 Ga0451837_0271177 3300041494 Bacteria 1574
138 Ga0451841_0328968 3300041498 Bacteria 1676
139 Ga0451843_0189011 3300041509 Bacteria 1489
140 Ga0451853_3684033 3300041512 Bacteria 4944
141 Ga0466965_0081827 3300044683 Bacteria 1633
142 Ga0466965_0341403 3300044683 Bacteria 819
143 Ga0466966_0065694 3300044684 Bacteria 2281
144 Ga0466966_0090234 3300044684 Bacteria 1903
145 Ga0466970_0003003 3300044765 Bacteria 8183
146 Ga0466970_0229086 3300044765 Bacteria 1038
147 Ga0466957_0116793 3300044842 Bacteria 1698
148 Ga0466957_0206759 3300044842 Bacteria 1291
149 Ga0466960_0114764 3300044901 Bacteria 1404
150 Ga0466958_0031261 3300045836 Bacteria 3164
151 Ga0495627_048865 3300046453 Bacteria 1279
152 Ga0495603_0007448 3300046455 Bacteria 6582
153 Ga0495603_0162641 3300046455 Bacteria 1294
154 Ga0495638_0066911 3300046460 Bacteria 2207
155 Ga0495594_0007493 3300046499 Bacteria 5619
156 Ga0495608_0386252 3300046511 Bacteria 858
157 Ga0495618_0140985 3300046514 Bacteria 1542
158 Ga0495652_0217195 3300046529 Bacteria 1439
159 Ga0495640_0014451 3300046533 Bacteria 5974
160 Ga0495587_0279340 3300046536 Bacteria 936
161 Ga0495668_0170668 3300046616 Bacteria 1192
162 Ga0495611_0012073 3300046648 Bacteria 3670
163 Ga0495625_0038032 3300046660 Bacteria 3525
164 Ga0495635_0141533 3300046663 Bacteria 1638
165 Ga0495661_0244050 3300046665 Bacteria 920
166 Ga0495646_0031357 3300046680 Bacteria 3313
167 Ga0495646_0333071 3300046680 Bacteria 798
168 Ga0495589_0019494 3300046794 Bacteria 3475
169 Ga0495581_0283906 3300047315 Bacteria 968
170 Ga0495581_0431355 3300047315 Bacteria 768
171 Ga0495674_0000950 3300047319 Bacteria 27650
172 Ga0495676_0070063 3300047321 Bacteria 2703
173 Ga0495676_0165010 3300047321 Bacteria 1563
174 Ga0495680_0113031 3300047322 Bacteria 2011
175 Ga0495685_005008 3300047447 Bacteria 4308
176 Ga0495593_0274226 3300047673 Bacteria 844
177 Ga0496101_0011447 3300048904 Bacteria 5887
178 Ga0496102_0190931 3300048905 Bacteria 1930
179 Ga0496103_0028957 3300048906 Bacteria 3364
180 Ga0496103_0174904 3300048906 Bacteria 1379
181 Ga0496105_0030391 3300048908 Bacteria 4426
182 Ga0496106_0063558 3300048909 Bacteria 2806
183 Ga0496110_0421641 3300048913 Bacteria 1217
184 Ga0496112_0185978 3300048915 Bacteria 2041
185 Ga0496114_0015208 3300048917 Bacteria 6186
186 Ga0496114_0216224 3300048917 Bacteria 1682
187 Ga0496114_0348561 3300048917 Bacteria 1309
188 Ga0496115_0191028 3300048918 Bacteria 1692
189 Ga0496120_0015305 3300048923 Bacteria 5069
190 Ga0501067_0114915 3300049583 Bacteria 1497
191 nmdc:mga08y16_232717_c1 3300050511 Bacteria 1906
192 nmdc:mga0n895_23528_c1 3300050512 Bacteria 5792
193 Ga0495601_0099420 3300053077 Bacteria 1878
194 Ga0495612_0155387 3300053078 Bacteria 997
195 Ga0500616_0000190 3300053153 Bacteria 100836
196 Ga0500630_099568 3300053159 Bacteria 1327
197 Ga0466962_0114060 3300061719 Bacteria 1302
198 2644610062 2643221711 Bacteria 4865335
199 2753263525 2751185782 Bacteria 11227053
200 2812372216 2811994882 Bacteria 4688362
201 2819425397 2818991318 Bacteria 5266538
202 2819667775 2818991458 Bacteria 4794049
203 2819691036 2818991462 Bacteria 4320267
204 2819727624 2818991469 Bacteria 4644110
205 2855686739 2855683550 Bacteria 7134265
206 2862577422 2862574272 Bacteria 10567477
207 2984580325 2984576629 Bacteria 4248407
208 2990258018 2990256926 Bacteria 4252839
209 Ga0157376_10790228
210 JGI25406J46586_10002653
211 Ga0055527_1000005
212 Ga0055542_1000006
213 Ga0055529_1000013
214 Ga0070683_100000701
215 Ga0070670_100101516
216 Ga0068869_100006636
217 Ga0070682_100058140
218 Ga0068868_100959160
219 Ga0070661_100055494
220 Ga0070661_100123865
221 Ga0070668_100000331
222 Ga0070675_100000555
223 Ga0070675_100642165
224 Ga0070671_100531808
225 Ga0070674_100058881
226 Ga0070659_100109534
227 Ga0070667_100028654
228 Ga0070709_10009402
229 Ga0070714_100027191
230 Ga0070713_100378371
231 Ga0070713_100504021
232 Ga0070710_10002570
233 Ga0070700_100002952
234 Ga0070663_100004059
235 Ga0070707_100049490
236 Ga0070699_100097840
237 Ga0070684_100001133
238 Ga0070697_100010129
239 Ga0070672_100019545
240 Ga0070664_100013204
241 Ga0068857_100002994
242 Ga0068852_100870809
243 Ga0068859_100490374
244 Ga0068861_100108448
245 Ga0068863_100501688
246 Ga0068858_100012460
247 Ga0068860_100021945
248 Ga0068860_100808473
249 Ga0068862_100007306
250 Ga0068862_100087427
251 Ga0081455_10071073
252 Ga0081539_10006212
253 Ga0070716_100416750
254 Ga0097621_100873731
255 Ga0075434_100023461
256 Ga0068865_100677241
257 Ga0111539_10004523
258 Ga0105245_10005301
259 Ga0114129_10381516
260 Ga0114129_10719952
261 Ga0105243_10891029
262 Ga0105238_10120288
263 Ga0105249_10093676
264 Ga0105239_10044044
265 Ga0157378_10773271
266 Ga0163163_10544344
267 Ga0163163_10945803
268 Ga0157377_10001573
269 Ga0209672_100003
270 Ga0209147_100744
271 Ga0209148_1000004
272 Ga0209455_1000022
273 Ga0207688_10010466
274 Ga0207645_10257525
275 Ga0207693_10239191
276 Ga0207649_10036165
277 Ga0207650_10032993
278 Ga0207659_10090486
279 Ga0207687_10040640
280 Ga0207700_10134054
281 Ga0207700_10259716
282 Ga0207664_10194688
283 Ga0207664_10558397
284 Ga0207690_10024242
285 Ga0207709_10373037
286 Ga0207669_10062937
287 Ga0207691_10014012
288 Ga0207691_10166271
289 Ga0207689_10000906
290 Ga0207689_10197424
291 Ga0207661_10023911
292 Ga0207679_10086163
293 Ga0207679_10548868
294 Ga0207668_10164522
295 Ga0207658_10015781
296 Ga0207658_10035574
297 Ga0207703_10028145
298 Ga0207678_10005907
299 Ga0207708_10000756
300 Ga0207641_10487520
301 Ga0207674_10032510
302 Ga0207698_10022460
303 Ga0207428_10004524
304 Ga0268265_10059926
305 Ga0268265_10077421
306 Ga0268265_10094093
307 Ga0268264_10023840
308 Ga0307515_10000205
309 Ga0307515_10033707
310 Ga0265330_10012066
311 Ga0265328_10051995
312 Ga0265329_10000313
313 Ga0265339_10048459
314 Ga0265316_10002561
315 Ga0307513_10047745
316 Ga0307513_10131805
317 Ga0307509_10400777
318 Ga0265314_10241422
319 Ga0265342_10000363
320 Ga0307516_10000409
321 Ga0307516_10010365
322 Ga0307516_10201064
323 Ga0307405_10140040
324 Ga0307410_10005516
325 Ga0307407_10007245
326 Ga0307409_100022836
327 Ga0307416_100167499
328 Ga0307411_10191060
329 Ga0307415_100003271
330 Ga0307415_100276231
331 Ga0373946_0032528
332 Ga0373935_0025520
333 Ga0373927_0117756
334 Ga0373933_0128487
335 Ga0373937_0858010
336 Ga0373925_0194096
337 Ga0373925_0258742
338 Ga0436364_0020241
339 Ga0436363_1483276
340 Ga0451789_0854181
341 Ga0451791_0456307
342 Ga0451797_1236517
343 Ga0451800_1437463
344 Ga0451833_1369568
345 Ga0451837_0271177
346 Ga0451841_0328968
347 Ga0451843_0189011
348 Ga0451853_3684033
349 Ga0466965_0081827
350 Ga0466965_0341403
351 Ga0466966_0065694
352 Ga0466966_0090234
353 Ga0466970_0003003
354 Ga0466970_0229086
355 Ga0466957_0116793
356 Ga0466957_0206759
357 Ga0466960_0114764
358 Ga0466958_0031261
359 Ga0495627_048865
360 Ga0495603_0007448
361 Ga0495603_0162641
362 Ga0495638_0066911
363 Ga0495594_0007493
364 Ga0495608_0386252
365 Ga0495618_0140985
366 Ga0495652_0217195
367 Ga0495640_0014451
368 Ga0495587_0279340
369 Ga0495668_0170668
370 Ga0495611_0012073
371 Ga0495625_0038032
372 Ga0495635_0141533
373 Ga0495661_0244050
374 Ga0495646_0031357
375 Ga0495646_0333071
376 Ga0495589_0019494
377 Ga0495581_0283906
378 Ga0495581_0431355
379 Ga0495674_0000950
380 Ga0495676_0070063
381 Ga0495676_0165010
382 Ga0495680_0113031
383 Ga0495685_005008
384 Ga0495593_0274226
385 Ga0496101_0011447
386 Ga0496102_0190931
387 Ga0496103_0028957
388 Ga0496103_0174904
389 Ga0496105_0030391
390 Ga0496106_0063558
391 Ga0496110_0421641
392 Ga0496112_0185978
393 Ga0496114_0015208
394 Ga0496114_0216224
395 Ga0496114_0348561
396 Ga0496115_0191028
397 Ga0496120_0015305
398 Ga0501067_0114915
399 nmdc:mga08y16_232717_c1
400 nmdc:mga0n895_23528_c1
401 Ga0495601_0099420
402 Ga0495612_0155387
403 Ga0500616_0000190
404 Ga0500630_099568
405 Ga0466962_0114060
406 2644610062
407 2753263525
408 2812372216
409 2819425397
410 2819667775
411 2819691036
412 2819727624
413 2855686739
414 2862577422
415 2984580325
416 2990258018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

50

139

0.97

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

50

152

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9699 28 56
5mog-assembly1.cif.gz_C oryza sativa phytoene desaturase inhibited by norflurazon 0.9594 27 56
3inr-assembly1.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (oxidized) 0.957 27 57
3int-assembly3.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (reduced) 0.953 27 57
8gsm-assembly1.cif.gz_G crystal structure of vibmo1 0.9521 27 57
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9785 27 58 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9657 30 58 3.50.50.60
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9407 25 57 3.50.50.60
af_Q21795_3_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9358 30 57 3.50.50.60
2e5vA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9297 30 59 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3D0R1J7-F1-model_v4 NADP oxidoreductase 1.002 29 112
AF-A0A2A3J5E1-F1-model_v4 Coenzyme F420-dependent NADP oxidoreductase-like protein 1 27 110
AF-A0A1G7MG79-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.9988 27 95
AF-A0A4Q5T0Z2-F1-model_v4 NADP oxidoreductase 0.9986 27 144
AF-A0A3D3KUS7-F1-model_v4 NADP oxidoreductase 0.9966 27 163

Map