F317792

General Info

Members Datasets Scaffolds Average Seq Length
208 136 208 131

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10180642|Ga0157370_101806422
Length 158
Sequence VVGAHPTGKAHPDETERCASDTRVARNAVIVLDASVVVELLTNGPLADPLRRDLAGRSVPFLVPHLLDVEVASALRNLSSGQRIDSHRSDQLLAELAALPAERYAHTPLLGRIWELRHNFTAYDAAYIALAEATGSVLYTCDEKLRKGHRAQVALFTR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
84 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000083 3300000546 Bacteria 13719
2 Ga0065707_10467947 3300005295 Bacteria 781
3 Ga0070683_100171525 3300005329 Unclassified 2059
4 Ga0070683_101443365 3300005329 Bacteria 661
5 Ga0068868_100048469 3300005338 Unclassified 3332
6 Ga0070689_100885165 3300005340 Unclassified 789
7 Ga0070673_100190313 3300005364 Bacteria 1762
8 Ga0070688_100452231 3300005365 Unclassified 960
9 Ga0070688_101080476 3300005365 Unclassified 641
10 Ga0070659_101311306 3300005366 Unclassified 642
11 Ga0070659_101478822 3300005366 Unclassified 605
12 Ga0070709_10070825 3300005434 Bacteria 2249
13 Ga0070709_10079255 3300005434 Unclassified 2139
14 Ga0070709_10713980 3300005434 Unclassified 781
15 Ga0070709_11049401 3300005434 Unclassified 650
16 Ga0070714_100249198 3300005435 Bacteria 1642
17 Ga0070713_100033714 3300005436 Bacteria 4105
18 Ga0070710_10112331 3300005437 Unclassified 1638
19 Ga0070711_100356249 3300005439 Unclassified 1177
20 Ga0070663_100965584 3300005455 Bacteria 739
21 Ga0070681_10020870 3300005458 Bacteria 6560
22 Ga0070681_10171594 3300005458 Bacteria 2091
23 Ga0070681_10874783 3300005458 Unclassified 817
24 Ga0068867_100580225 3300005459 Unclassified 975
25 Ga0070685_10285958 3300005466 Bacteria 1106
26 Ga0070706_100187300 3300005467 Bacteria 1934
27 Ga0070699_100088145 3300005518 Unclassified 2710
28 Ga0070679_100108529 3300005530 Unclassified 2761
29 Ga0070679_100921789 3300005530 Unclassified 817
30 Ga0070684_100028437 3300005535 Bacteria 4729
31 Ga0070697_101088085 3300005536 Unclassified 711
32 Ga0068853_100900863 3300005539 Unclassified 849
33 Ga0070686_101294810 3300005544 Unclassified 608
34 Ga0070665_100023533 3300005548 Bacteria 6202
35 Ga0070665_100082666 3300005548 Bacteria 3217
36 Ga0068852_100314348 3300005616 Unclassified 1519
37 Ga0068864_100163991 3300005618 Unclassified 2022
38 Ga0068851_10104826 3300005834 Unclassified 1504
39 Ga0068863_100184823 3300005841 Bacteria 2002
40 Ga0068863_101454416 3300005841 Unclassified 693
41 Ga0068858_100031102 3300005842 Unclassified 4957
42 Ga0068860_102321623 3300005843 Unclassified 557
43 Ga0070717_10017650 3300006028 Bacteria 5556
44 Ga0070717_10273561 3300006028 Bacteria 1496
45 Ga0070717_10340447 3300006028 Unclassified 1339
46 Ga0070717_10714222 3300006028 Unclassified 911
47 Ga0070717_11139399 3300006028 Unclassified 710
48 Ga0070716_100138220 3300006173 Unclassified 1550
49 Ga0070716_100183561 3300006173 Bacteria 1376
50 Ga0070716_100964377 3300006173 Unclassified 672
51 Ga0070712_100162583 3300006175 Bacteria 1725
52 Ga0070712_100586544 3300006175 Unclassified 942
53 Ga0070712_100815814 3300006175 Unclassified 801
54 Ga0097621_100423652 3300006237 Unclassified 1195
55 Ga0097621_101157912 3300006237 Unclassified 727
56 Ga0068871_100578236 3300006358 Bacteria 1020
57 Ga0075436_100082269 3300006914 Unclassified 2233
58 Ga0075435_100518786 3300007076 Unclassified 1031
59 Ga0105240_10127397 3300009093 Bacteria 3057
60 Ga0105240_10702472 3300009093 Bacteria 1104
61 Ga0105245_12731155 3300009098 Unclassified 547
62 Ga0105245_12740520 3300009098 Unclassified 546
63 Ga0114129_10358914 3300009147 Unclassified 1929
64 Ga0114129_10415407 3300009147 Bacteria 1771
65 Ga0105243_12349008 3300009148 Unclassified 571
66 Ga0105241_10008117 3300009174 Bacteria 7728
67 Ga0105241_10113061 3300009174 Bacteria 2176
68 Ga0105241_10878651 3300009174 Bacteria 831
69 Ga0105248_10201087 3300009177 Bacteria 2245
70 Ga0105248_10330661 3300009177 Bacteria 1716
71 Ga0105248_10568641 3300009177 Unclassified 1279
72 Ga0105237_11633649 3300009545 Unclassified 651
73 Ga0105238_10063539 3300009551 Bacteria 3692
74 Ga0105238_10401758 3300009551 Bacteria 1363
75 Ga0105238_10768580 3300009551 Bacteria 978
76 Ga0105238_11638363 3300009551 Unclassified 674
77 Ga0105249_11881130 3300009553 Unclassified 671
78 Ga0105239_10080686 3300010375 Bacteria 3580
79 Ga0105239_10895503 3300010375 Unclassified 1018
80 Ga0157373_10526001 3300013100 Unclassified 856
81 Ga0157370_10180642 3300013104 Unclassified 1961
82 Ga0157374_10036618 3300013296 Bacteria 4495
83 Ga0157378_10005362 3300013297 Bacteria 11249
84 Ga0157378_10860878 3300013297 Bacteria 935
85 Ga0163162_10775798 3300013306 Bacteria 1077
86 Ga0157375_10574468 3300013308 Unclassified 1288
87 Ga0157375_11941116 3300013308 Unclassified 699
88 Ga0157375_11975790 3300013308 Unclassified 693
89 Ga0163163_10045717 3300014325 Unclassified 4299
90 Ga0163163_10048324 3300014325 Unclassified 4184
91 Ga0163163_11488855 3300014325 Bacteria 738
92 Ga0157379_10369951 3300014968 Unclassified 1314
93 Ga0157376_10071426 3300014969 Bacteria 2950
94 Ga0157376_10498367 3300014969 Bacteria 1196
95 Ga0213875_10000024 3300021388 Bacteria 200333
96 Ga0213875_10003537 3300021388 Bacteria 8877
97 Ga0213875_10011714 3300021388 Bacteria 4353
98 Ga0224712_10199803 3300022467 Bacteria 908
99 Ga0207680_10263473 3300025903 Bacteria 1194
100 Ga0207699_10108521 3300025906 Bacteria 1775
101 Ga0207699_10159369 3300025906 Bacteria 1501
102 Ga0207695_10927136 3300025913 Unclassified 750
103 Ga0207693_10168111 3300025915 Bacteria 1727
104 Ga0207693_10347080 3300025915 Bacteria 1162
105 Ga0207663_10865173 3300025916 Unclassified 722
106 Ga0207652_10569094 3300025921 Bacteria 1017
107 Ga0207652_11717367 3300025921 Unclassified 532
108 Ga0207694_10121571 3300025924 Bacteria 2085
109 Ga0207700_10004808 3300025928 Bacteria 8018
110 Ga0207664_10127039 3300025929 Bacteria 2142
111 Ga0207670_11291154 3300025936 Unclassified 619
112 Ga0207704_10193722 3300025938 Bacteria 1481
113 Ga0207665_10291120 3300025939 Bacteria 1218
114 Ga0207665_10395546 3300025939 Unclassified 1051
115 Ga0207665_10724337 3300025939 Bacteria 783
116 Ga0207711_11553936 3300025941 Unclassified 605
117 Ga0207711_11604077 3300025941 Unclassified 594
118 Ga0207661_10043023 3300025944 Unclassified 3564
119 Ga0207677_10648956 3300026023 Unclassified 931
120 Ga0207703_10069228 3300026035 Viruses 2910
121 Ga0207703_11110564 3300026035 Bacteria 760
122 Ga0207641_10249704 3300026088 Bacteria 1656
123 Ga0207641_11441614 3300026088 Bacteria 690
124 Ga0207648_10827975 3300026089 Unclassified 862
125 Ga0207676_11313868 3300026095 Unclassified 718
126 Ga0207674_10202184 3300026116 Bacteria 1936
127 Ga0207698_10166874 3300026142 Bacteria 1933
128 Ga0268266_12218614 3300028379 Unclassified 521
129 Ga0268264_10234683 3300028381 Bacteria 1696
130 Ga0265323_10000176 3300028653 Bacteria 38367
131 Ga0265762_1002272 3300030760 Bacteria 3472
132 Ga0265760_10367702 3300031090 Unclassified 516
133 Ga0265330_10026748 3300031235 Bacteria 2608
134 Ga0265331_10053356 3300031250 Bacteria 1929
135 Ga0265316_10002585 3300031344 Bacteria 18691
136 Ga0265316_10016399 3300031344 Bacteria 6427
137 Ga0265316_10090983 3300031344 Bacteria 2328
138 Ga0265316_10131673 3300031344 Bacteria 1883
139 Ga0265316_10149187 3300031344 Bacteria 1752
140 Ga0265316_10162726 3300031344 Bacteria 1668
141 Ga0265342_10264900 3300031712 Bacteria 913
142 Ga0307516_10919695 3300031730 Unclassified 542
143 Ga0307406_10697368 3300031901 Unclassified 847
144 Ga0316214_1034790 3300033545 Unclassified 718
145 Ga0373934_0281792 3300035086 Unclassified 688
146 Ga0373953_0011912 3300035117 Bacteria 3065
147 Ga0373954_0495119 3300035118 Bacteria 605
148 Ga0373957_0118663 3300035120 Unclassified 1070
149 Ga0373943_0147494 3300035170 Bacteria 1272
150 Ga0373955_0009445 3300035172 Bacteria 4567
151 Ga0373924_0142782 3300035410 Unclassified 1045
152 Ga0373927_0002875 3300035695 Bacteria 12538
153 Ga0373927_0446286 3300035695 Bacteria 854
154 Ga0373933_0234636 3300035724 Bacteria 1179
155 Ga0373947_0004230 3300035725 Bacteria 8418
156 Ga0373947_0279115 3300035725 Bacteria 1110
157 Ga0373947_0622350 3300035725 Unclassified 736
158 Ga0373937_0049161 3300036401 Bacteria 3862
159 Ga0373937_0407759 3300036401 Bacteria 1290
160 Ga0373937_1391927 3300036401 Unclassified 649
161 Ga0373925_0000470 3300037068 Bacteria 40239
162 Ga0373925_0825176 3300037068 Bacteria 764
163 Ga0395900_1377256 3300037418 Unclassified 619
164 Ga0395898_0960453 3300037466 Unclassified 791
165 Ga0436364_0465037 3300037853 Unclassified 711
166 Ga0436364_1081322 3300037853 Bacteria 1372
167 Ga0436364_1169042 3300037853 Bacteria 9848
168 Ga0436364_1265330 3300037853 Bacteria 89074
169 Ga0436364_1321932 3300037853 Bacteria 3231
170 Ga0436364_1349063 3300037853 Unclassified 1101
171 Ga0436360_1258247 3300039438 Bacteria 886
172 Ga0466963_0561980 3300044694 Unclassified 806
173 Ga0451576_0943022 3300045051 Unclassified 905
174 Ga0495580_0048763 3300046472 Unclassified 2996
175 Ga0495662_0504753 3300046476 Bacteria 593
176 Ga0495594_0820319 3300046499 Bacteria 524
177 Ga0495628_0058449 3300046516 Bacteria 3030
178 Ga0495628_0670783 3300046516 Unclassified 735
179 Ga0495630_0971798 3300046517 Bacteria 646
180 Ga0495652_0426886 3300046529 Bacteria 933
181 Ga0495652_0463699 3300046529 Unclassified 885
182 Ga0495665_0075612 3300046531 Unclassified 1773
183 Ga0495665_0601323 3300046531 Unclassified 550
184 Ga0495667_0092413 3300046559 Bacteria 1959
185 Ga0495667_0138172 3300046559 Unclassified 1571
186 Ga0495667_0292356 3300046559 Bacteria 1033
187 Ga0495588_0311438 3300046674 Bacteria 828
188 Ga0495623_0026648 3300046679 Bacteria 3719
189 Ga0495623_0148416 3300046679 Bacteria 1388
190 Ga0495623_0347900 3300046679 Bacteria 808
191 Ga0495658_0832991 3300046683 Bacteria 590
192 Ga0495624_0145773 3300046690 Bacteria 1449
193 Ga0495675_0077592 3300047444 Unclassified 2093
194 Ga0495684_0331903 3300047471 Unclassified 1084
195 Ga0495602_0197376 3300048088 Unclassified 1538
196 Ga0496102_0432707 3300048905 Bacteria 1235
197 Ga0496102_1435990 3300048905 Unclassified 609
198 Ga0496111_0001330 3300048914 Bacteria 13912
199 Ga0496114_0609695 3300048917 Bacteria 962
200 Ga0496115_0320373 3300048918 Bacteria 1268
201 Ga0501298_065490 3300049521 Bacteria 776
202 Ga0501040_0441204 3300049576 Bacteria 937
203 Ga0501040_1417137 3300049576 Unclassified 504
204 Ga0501075_0371870 3300049591 Bacteria 1089
205 Ga0501081_0768845 3300049743 Bacteria 724
206 Ga0501045_1011818 3300049824 Bacteria 609
207 nmdc:mga05p37_360113_c1 3300050507 Unclassified 1710
208 Ga0495612_0429690 3300053078 Unclassified 602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0432707 Ga0496102_0432707_394_759 121
2 3300031901 Ga0307406_10697368 Ga0307406_106973682 126
3 3300014325 Ga0163163_11488855 Ga0163163_114888551 127
4 3300035695 Ga0373927_0002875 Ga0373927_0002875_2691_3086 127
5 3300005295 Ga0065707_10467947 Ga0065707_104679471 128
6 3300005329 Ga0070683_101443365 Ga0070683_1014433651 128
7 3300005340 Ga0070689_100885165 Ga0070689_1008851652 128
8 3300005364 Ga0070673_100190313 Ga0070673_1001903133 128
9 3300005365 Ga0070688_100452231 Ga0070688_1004522313 128
10 3300005455 Ga0070663_100965584 Ga0070663_1009655841 128
11 3300005458 Ga0070681_10171594 Ga0070681_101715943 128
12 3300005459 Ga0068867_100580225 Ga0068867_1005802253 128
13 3300005518 Ga0070699_100088145 Ga0070699_1000881453 128
14 3300005530 Ga0070679_100108529 Ga0070679_1001085291 128
15 3300005548 Ga0070665_100082666 Ga0070665_1000826664 128
16 3300005618 Ga0068864_100163991 Ga0068864_1001639912 128
17 3300005841 Ga0068863_100184823 Ga0068863_1001848232 128
18 3300005842 Ga0068858_100031102 Ga0068858_1000311026 128
19 3300005843 Ga0068860_102321623 Ga0068860_1023216231 128
20 3300006028 Ga0070717_10017650 Ga0070717_100176504 128
21 3300006028 Ga0070717_10273561 Ga0070717_102735612 128
22 3300006173 Ga0070716_100183561 Ga0070716_1001835612 128
23 3300006237 Ga0097621_100423652 Ga0097621_1004236522 128
24 3300006358 Ga0068871_100578236 Ga0068871_1005782362 128
25 3300009093 Ga0105240_10127397 Ga0105240_101273975 128
26 3300009147 Ga0114129_10358914 Ga0114129_103589142 128
27 3300009147 Ga0114129_10415407 Ga0114129_104154073 128
28 3300009177 Ga0105248_10330661 Ga0105248_103306612 128
29 3300009177 Ga0105248_10568641 Ga0105248_105686412 128
30 3300009551 Ga0105238_10401758 Ga0105238_104017584 128
31 3300009553 Ga0105249_11881130 Ga0105249_118811301 128
32 3300010375 Ga0105239_10895503 Ga0105239_108955031 128
33 3300013104 Ga0157370_10180642 Ga0157370_101806422 128
34 3300013306 Ga0163162_10775798 Ga0163162_107757982 128
35 3300013308 Ga0157375_10574468 Ga0157375_105744682 128
36 3300013308 Ga0157375_11941116 Ga0157375_119411162 128
37 3300014325 Ga0163163_10045717 Ga0163163_100457173 128
38 3300014325 Ga0163163_10048324 Ga0163163_100483244 128
39 3300014968 Ga0157379_10369951 Ga0157379_103699512 128
40 3300014969 Ga0157376_10071426 Ga0157376_100714263 128
41 3300014969 Ga0157376_10498367 Ga0157376_104983673 128
42 3300021388 Ga0213875_10000024 Ga0213875_10000024162 128
43 3300021388 Ga0213875_10003537 Ga0213875_100035373 128
44 3300021388 Ga0213875_10011714 Ga0213875_100117145 128
45 3300022467 Ga0224712_10199803 Ga0224712_101998032 128
46 3300025903 Ga0207680_10263473 Ga0207680_102634733 128
47 3300025921 Ga0207652_10569094 Ga0207652_105690943 128
48 3300025936 Ga0207670_11291154 Ga0207670_112911542 128
49 3300025939 Ga0207665_10724337 Ga0207665_107243371 128
50 3300025941 Ga0207711_11553936 Ga0207711_115539361 128
51 3300025941 Ga0207711_11604077 Ga0207711_116040771 128
52 3300025944 Ga0207661_10043023 Ga0207661_100430233 128
53 3300026035 Ga0207703_10069228 Ga0207703_100692283 128
54 3300026088 Ga0207641_10249704 Ga0207641_102497042 128
55 3300026088 Ga0207641_11441614 Ga0207641_114416142 128
56 3300026089 Ga0207648_10827975 Ga0207648_108279751 128
57 3300026095 Ga0207676_11313868 Ga0207676_113138681 128
58 3300028379 Ga0268266_12218614 Ga0268266_122186141 128
59 3300028653 Ga0265323_10000176 Ga0265323_1000017625 128
60 3300031090 Ga0265760_10367702 Ga0265760_103677021 128
61 3300031235 Ga0265330_10026748 Ga0265330_100267483 128
62 3300031250 Ga0265331_10053356 Ga0265331_100533564 128
63 3300031344 Ga0265316_10002585 Ga0265316_1000258515 128
64 3300031344 Ga0265316_10016399 Ga0265316_100163994 128
65 3300031344 Ga0265316_10090983 Ga0265316_100909832 128
66 3300031344 Ga0265316_10131673 Ga0265316_101316732 128
67 3300031344 Ga0265316_10149187 Ga0265316_101491872 128
68 3300031344 Ga0265316_10162726 Ga0265316_101627262 128
69 3300031712 Ga0265342_10264900 Ga0265342_102649003 128
70 3300035117 Ga0373953_0011912 Ga0373953_0011912_520_912 128
71 3300035118 Ga0373954_0495119 Ga0373954_0495119_96_488 128
72 3300035170 Ga0373943_0147494 Ga0373943_0147494_701_1093 128
73 3300035172 Ga0373955_0009445 Ga0373955_0009445_787_1179 128
74 3300035695 Ga0373927_0446286 Ga0373927_0446286_261_653 128
75 3300035725 Ga0373947_0004230 Ga0373947_0004230_1788_2180 128
76 3300035725 Ga0373947_0279115 Ga0373947_0279115_149_541 128
77 3300035725 Ga0373947_0622350 Ga0373947_0622350_137_529 128
78 3300036401 Ga0373937_0049161 Ga0373937_0049161_2632_3024 128
79 3300037068 Ga0373925_0000470 Ga0373925_0000470_6254_6646 128
80 3300037068 Ga0373925_0825176 Ga0373925_0825176_222_614 128
81 3300037466 Ga0395898_0960453 Ga0395898_0960453_256_729 128
82 3300037853 Ga0436364_0465037 Ga0436364_0465037_273_662 128
83 3300037853 Ga0436364_1081322 Ga0436364_1081322_533_922 128
84 3300037853 Ga0436364_1169042 Ga0436364_1169042_2002_2403 128
85 3300037853 Ga0436364_1265330 Ga0436364_1265330_65137_65529 128
86 3300037853 Ga0436364_1321932 Ga0436364_1321932_1864_2256 128
87 3300037853 Ga0436364_1349063 Ga0436364_1349063_606_1007 128
88 3300039438 Ga0436360_1258247 Ga0436360_1258247_208_600 128
89 3300044694 Ga0466963_0561980 Ga0466963_0561980_232_633 128
90 3300045051 Ga0451576_0943022 Ga0451576_0943022_345_737 128
91 3300046472 Ga0495580_0048763 Ga0495580_0048763_870_1262 128
92 3300046476 Ga0495662_0504753 Ga0495662_0504753_111_500 128
93 3300046499 Ga0495594_0820319 Ga0495594_0820319_100_489 128
94 3300046516 Ga0495628_0058449 Ga0495628_0058449_2041_2433 128
95 3300046516 Ga0495628_0670783 Ga0495628_0670783_182_583 128
96 3300046517 Ga0495630_0971798 Ga0495630_0971798_77_466 128
97 3300046529 Ga0495652_0426886 Ga0495652_0426886_410_802 128
98 3300046529 Ga0495652_0463699 Ga0495652_0463699_112_513 128
99 3300046531 Ga0495665_0075612 Ga0495665_0075612_259_651 128
100 3300046559 Ga0495667_0092413 Ga0495667_0092413_1165_1557 128
101 3300046559 Ga0495667_0138172 Ga0495667_0138172_70_462 128
102 3300046559 Ga0495667_0292356 Ga0495667_0292356_615_1007 128
103 3300046674 Ga0495588_0311438 Ga0495588_0311438_164_556 128
104 3300046679 Ga0495623_0026648 Ga0495623_0026648_3293_3685 128
105 3300046679 Ga0495623_0347900 Ga0495623_0347900_341_733 128
106 3300046683 Ga0495658_0832991 Ga0495658_0832991_56_448 128
107 3300046690 Ga0495624_0145773 Ga0495624_0145773_395_787 128
108 3300047471 Ga0495684_0331903 Ga0495684_0331903_606_998 128
109 3300048917 Ga0496114_0609695 Ga0496114_0609695_383_772 128
110 3300048918 Ga0496115_0320373 Ga0496115_0320373_638_1030 128
111 3300049521 Ga0501298_065490 Ga0501298_065490_214_606 128
112 3300049576 Ga0501040_0441204 Ga0501040_0441204_408_800 128
113 3300049576 Ga0501040_1417137 Ga0501040_1417137_69_461 128
114 3300049591 Ga0501075_0371870 Ga0501075_0371870_430_822 128
115 3300049743 Ga0501081_0768845 Ga0501081_0768845_105_497 128
116 3300049824 Ga0501045_1011818 Ga0501045_1011818_104_496 128
117 3300050507 nmdc:mga05p37_360113_c1 nmdc:mga05p37_360113_c1_342_734 128
118 3300005366 Ga0070659_101478822 Ga0070659_1014788221 129
119 3300031730 Ga0307516_10919695 Ga0307516_109196951 129
120 3300000546 LJNas_1000083 LJNas_10000833 130
121 3300005329 Ga0070683_100171525 Ga0070683_1001715251 130
122 3300005338 Ga0068868_100048469 Ga0068868_1000484694 130
123 3300005365 Ga0070688_101080476 Ga0070688_1010804761 130
124 3300005366 Ga0070659_101311306 Ga0070659_1013113061 130
125 3300005434 Ga0070709_10070825 Ga0070709_100708253 130
126 3300005434 Ga0070709_10079255 Ga0070709_100792553 130
127 3300005434 Ga0070709_10713980 Ga0070709_107139801 130
128 3300005434 Ga0070709_11049401 Ga0070709_110494012 130
129 3300005435 Ga0070714_100249198 Ga0070714_1002491982 130
130 3300005436 Ga0070713_100033714 Ga0070713_1000337142 130
131 3300005437 Ga0070710_10112331 Ga0070710_101123312 130
132 3300005439 Ga0070711_100356249 Ga0070711_1003562492 130
133 3300005458 Ga0070681_10020870 Ga0070681_100208704 130
134 3300005458 Ga0070681_10874783 Ga0070681_108747832 130
135 3300005466 Ga0070685_10285958 Ga0070685_102859582 130
136 3300005467 Ga0070706_100187300 Ga0070706_1001873004 130
137 3300005530 Ga0070679_100921789 Ga0070679_1009217891 130
138 3300005535 Ga0070684_100028437 Ga0070684_1000284372 130
139 3300005536 Ga0070697_101088085 Ga0070697_1010880851 130
140 3300005539 Ga0068853_100900863 Ga0068853_1009008632 130
141 3300005544 Ga0070686_101294810 Ga0070686_1012948101 130
142 3300005548 Ga0070665_100023533 Ga0070665_1000235331 130
143 3300005616 Ga0068852_100314348 Ga0068852_1003143483 130
144 3300005834 Ga0068851_10104826 Ga0068851_101048262 130
145 3300005841 Ga0068863_101454416 Ga0068863_1014544161 130
146 3300006028 Ga0070717_10340447 Ga0070717_103404472 130
147 3300006028 Ga0070717_10714222 Ga0070717_107142222 130
148 3300006028 Ga0070717_11139399 Ga0070717_111393991 130
149 3300006173 Ga0070716_100138220 Ga0070716_1001382205 130
150 3300006173 Ga0070716_100964377 Ga0070716_1009643771 130
151 3300006175 Ga0070712_100162583 Ga0070712_1001625832 130
152 3300006175 Ga0070712_100586544 Ga0070712_1005865441 130
153 3300006175 Ga0070712_100815814 Ga0070712_1008158142 130
154 3300006237 Ga0097621_101157912 Ga0097621_1011579121 130
155 3300006914 Ga0075436_100082269 Ga0075436_1000822694 130
156 3300007076 Ga0075435_100518786 Ga0075435_1005187863 130
157 3300009093 Ga0105240_10702472 Ga0105240_107024723 130
158 3300009098 Ga0105245_12731155 Ga0105245_127311551 130
159 3300009098 Ga0105245_12740520 Ga0105245_127405201 130
160 3300009148 Ga0105243_12349008 Ga0105243_123490082 130
161 3300009174 Ga0105241_10008117 Ga0105241_100081178 130
162 3300009174 Ga0105241_10113061 Ga0105241_101130614 130
163 3300009174 Ga0105241_10878651 Ga0105241_108786512 130
164 3300009177 Ga0105248_10201087 Ga0105248_102010872 130
165 3300009545 Ga0105237_11633649 Ga0105237_116336492 130
166 3300009551 Ga0105238_10063539 Ga0105238_100635391 130
167 3300009551 Ga0105238_10768580 Ga0105238_107685802 130
168 3300009551 Ga0105238_11638363 Ga0105238_116383632 130
169 3300010375 Ga0105239_10080686 Ga0105239_100806864 130
170 3300013100 Ga0157373_10526001 Ga0157373_105260011 130
171 3300013296 Ga0157374_10036618 Ga0157374_100366186 130
172 3300013297 Ga0157378_10005362 Ga0157378_100053625 130
173 3300013297 Ga0157378_10860878 Ga0157378_108608782 130
174 3300013308 Ga0157375_11975790 Ga0157375_119757901 130
175 3300025906 Ga0207699_10108521 Ga0207699_101085214 130
176 3300025906 Ga0207699_10159369 Ga0207699_101593692 130
177 3300025913 Ga0207695_10927136 Ga0207695_109271362 130
178 3300025915 Ga0207693_10168111 Ga0207693_101681114 130
179 3300025915 Ga0207693_10347080 Ga0207693_103470803 130
180 3300025916 Ga0207663_10865173 Ga0207663_108651732 130
181 3300025921 Ga0207652_11717367 Ga0207652_117173671 130
182 3300025924 Ga0207694_10121571 Ga0207694_101215713 130
183 3300025928 Ga0207700_10004808 Ga0207700_100048087 130
184 3300025929 Ga0207664_10127039 Ga0207664_101270394 130
185 3300025938 Ga0207704_10193722 Ga0207704_101937222 130
186 3300025939 Ga0207665_10291120 Ga0207665_102911201 130
187 3300025939 Ga0207665_10395546 Ga0207665_103955463 130
188 3300026023 Ga0207677_10648956 Ga0207677_106489562 130
189 3300026035 Ga0207703_11110564 Ga0207703_111105642 130
190 3300026116 Ga0207674_10202184 Ga0207674_102021841 130
191 3300026142 Ga0207698_10166874 Ga0207698_101668742 130
192 3300028381 Ga0268264_10234683 Ga0268264_102346833 130
193 3300030760 Ga0265762_1002272 Ga0265762_10022724 130
194 3300033545 Ga0316214_1034790 Ga0316214_10347902 130
195 3300035086 Ga0373934_0281792 Ga0373934_0281792_247_639 130
196 3300035120 Ga0373957_0118663 Ga0373957_0118663_638_1030 130
197 3300035410 Ga0373924_0142782 Ga0373924_0142782_59_451 130
198 3300035724 Ga0373933_0234636 Ga0373933_0234636_345_737 130
199 3300036401 Ga0373937_0407759 Ga0373937_0407759_206_598 130
200 3300036401 Ga0373937_1391927 Ga0373937_1391927_191_583 130
201 3300037418 Ga0395900_1377256 Ga0395900_1377256_65_457 130
202 3300046531 Ga0495665_0601323 Ga0495665_0601323_43_435 130
203 3300046679 Ga0495623_0148416 Ga0495623_0148416_213_605 130
204 3300047444 Ga0495675_0077592 Ga0495675_0077592_288_680 130
205 3300048088 Ga0495602_0197376 Ga0495602_0197376_794_1186 130
206 3300048905 Ga0496102_1435990 Ga0496102_1435990_21_413 130
207 3300048914 Ga0496111_0001330 Ga0496111_0001330_12912_13304 130
208 3300053078 Ga0495612_0429690 Ga0495612_0429690_73_465 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

30

150

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yef-assembly1.cif.gz_t 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9262 37 69
7p7r-assembly1.cif.gz_u poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state i 0.9252 39 70
7boe-assembly1.cif.gz_T bacterial 30s ribosomal subunit assembly complex state m (consensus refinement) 0.9146 39 70
3vmq-assembly1.cif.gz_A crystal structure of staphylococcus aureus membrane-bound transglycosylase: apoenzyme 0.9124 37 68
3ue1-assembly1.cif.gz_A crystal strucuture of acinetobacter baumanni pbp1a in complex with mc-1 0.9113 37 66
ID Description Score Start End Superfamily
af_P76577_56_250_1.10.3810.10 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9871 39 66 1.10.3810.10
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9768 1 122 3.40.50.1010
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9689 1 122 3.40.50.1010
5zeut00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9659 39 69 1.20.58.110
af_P9WFA9_1_117_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9452 1 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A5M8SWL0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9949 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A6N7W7T3-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9817 1 129 GO:0004518
AF-A0A7V9L908-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9816 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A536JKL2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9779 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A0A0JA68-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9775 2 130 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
93.15 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map