F317792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 208 | 136 | 208 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10180642|Ga0157370_101806422 |
| Length | 158 |
| Sequence | VVGAHPTGKAHPDETERCASDTRVARNAVIVLDASVVVELLTNGPLADPLRRDLAGRSVPFLVPHLLDVEVASALRNLSSGQRIDSHRSDQLLAELAALPAERYAHTPLLGRIWELRHNFTAYDAAYIALAEATGSVLYTCDEKLRKGHRAQVALFTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 59 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 91 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 92 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 93 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 95 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 97 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 99 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 129 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 130 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 131 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.56 |
| Metatranscriptomes | 1.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.4 |
| Rhizosphere | 92.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000083 | 3300000546 | Bacteria | 13719 |
| 2 | Ga0065707_10467947 | 3300005295 | Bacteria | 781 |
| 3 | Ga0070683_100171525 | 3300005329 | Unclassified | 2059 |
| 4 | Ga0070683_101443365 | 3300005329 | Bacteria | 661 |
| 5 | Ga0068868_100048469 | 3300005338 | Unclassified | 3332 |
| 6 | Ga0070689_100885165 | 3300005340 | Unclassified | 789 |
| 7 | Ga0070673_100190313 | 3300005364 | Bacteria | 1762 |
| 8 | Ga0070688_100452231 | 3300005365 | Unclassified | 960 |
| 9 | Ga0070688_101080476 | 3300005365 | Unclassified | 641 |
| 10 | Ga0070659_101311306 | 3300005366 | Unclassified | 642 |
| 11 | Ga0070659_101478822 | 3300005366 | Unclassified | 605 |
| 12 | Ga0070709_10070825 | 3300005434 | Bacteria | 2249 |
| 13 | Ga0070709_10079255 | 3300005434 | Unclassified | 2139 |
| 14 | Ga0070709_10713980 | 3300005434 | Unclassified | 781 |
| 15 | Ga0070709_11049401 | 3300005434 | Unclassified | 650 |
| 16 | Ga0070714_100249198 | 3300005435 | Bacteria | 1642 |
| 17 | Ga0070713_100033714 | 3300005436 | Bacteria | 4105 |
| 18 | Ga0070710_10112331 | 3300005437 | Unclassified | 1638 |
| 19 | Ga0070711_100356249 | 3300005439 | Unclassified | 1177 |
| 20 | Ga0070663_100965584 | 3300005455 | Bacteria | 739 |
| 21 | Ga0070681_10020870 | 3300005458 | Bacteria | 6560 |
| 22 | Ga0070681_10171594 | 3300005458 | Bacteria | 2091 |
| 23 | Ga0070681_10874783 | 3300005458 | Unclassified | 817 |
| 24 | Ga0068867_100580225 | 3300005459 | Unclassified | 975 |
| 25 | Ga0070685_10285958 | 3300005466 | Bacteria | 1106 |
| 26 | Ga0070706_100187300 | 3300005467 | Bacteria | 1934 |
| 27 | Ga0070699_100088145 | 3300005518 | Unclassified | 2710 |
| 28 | Ga0070679_100108529 | 3300005530 | Unclassified | 2761 |
| 29 | Ga0070679_100921789 | 3300005530 | Unclassified | 817 |
| 30 | Ga0070684_100028437 | 3300005535 | Bacteria | 4729 |
| 31 | Ga0070697_101088085 | 3300005536 | Unclassified | 711 |
| 32 | Ga0068853_100900863 | 3300005539 | Unclassified | 849 |
| 33 | Ga0070686_101294810 | 3300005544 | Unclassified | 608 |
| 34 | Ga0070665_100023533 | 3300005548 | Bacteria | 6202 |
| 35 | Ga0070665_100082666 | 3300005548 | Bacteria | 3217 |
| 36 | Ga0068852_100314348 | 3300005616 | Unclassified | 1519 |
| 37 | Ga0068864_100163991 | 3300005618 | Unclassified | 2022 |
| 38 | Ga0068851_10104826 | 3300005834 | Unclassified | 1504 |
| 39 | Ga0068863_100184823 | 3300005841 | Bacteria | 2002 |
| 40 | Ga0068863_101454416 | 3300005841 | Unclassified | 693 |
| 41 | Ga0068858_100031102 | 3300005842 | Unclassified | 4957 |
| 42 | Ga0068860_102321623 | 3300005843 | Unclassified | 557 |
| 43 | Ga0070717_10017650 | 3300006028 | Bacteria | 5556 |
| 44 | Ga0070717_10273561 | 3300006028 | Bacteria | 1496 |
| 45 | Ga0070717_10340447 | 3300006028 | Unclassified | 1339 |
| 46 | Ga0070717_10714222 | 3300006028 | Unclassified | 911 |
| 47 | Ga0070717_11139399 | 3300006028 | Unclassified | 710 |
| 48 | Ga0070716_100138220 | 3300006173 | Unclassified | 1550 |
| 49 | Ga0070716_100183561 | 3300006173 | Bacteria | 1376 |
| 50 | Ga0070716_100964377 | 3300006173 | Unclassified | 672 |
| 51 | Ga0070712_100162583 | 3300006175 | Bacteria | 1725 |
| 52 | Ga0070712_100586544 | 3300006175 | Unclassified | 942 |
| 53 | Ga0070712_100815814 | 3300006175 | Unclassified | 801 |
| 54 | Ga0097621_100423652 | 3300006237 | Unclassified | 1195 |
| 55 | Ga0097621_101157912 | 3300006237 | Unclassified | 727 |
| 56 | Ga0068871_100578236 | 3300006358 | Bacteria | 1020 |
| 57 | Ga0075436_100082269 | 3300006914 | Unclassified | 2233 |
| 58 | Ga0075435_100518786 | 3300007076 | Unclassified | 1031 |
| 59 | Ga0105240_10127397 | 3300009093 | Bacteria | 3057 |
| 60 | Ga0105240_10702472 | 3300009093 | Bacteria | 1104 |
| 61 | Ga0105245_12731155 | 3300009098 | Unclassified | 547 |
| 62 | Ga0105245_12740520 | 3300009098 | Unclassified | 546 |
| 63 | Ga0114129_10358914 | 3300009147 | Unclassified | 1929 |
| 64 | Ga0114129_10415407 | 3300009147 | Bacteria | 1771 |
| 65 | Ga0105243_12349008 | 3300009148 | Unclassified | 571 |
| 66 | Ga0105241_10008117 | 3300009174 | Bacteria | 7728 |
| 67 | Ga0105241_10113061 | 3300009174 | Bacteria | 2176 |
| 68 | Ga0105241_10878651 | 3300009174 | Bacteria | 831 |
| 69 | Ga0105248_10201087 | 3300009177 | Bacteria | 2245 |
| 70 | Ga0105248_10330661 | 3300009177 | Bacteria | 1716 |
| 71 | Ga0105248_10568641 | 3300009177 | Unclassified | 1279 |
| 72 | Ga0105237_11633649 | 3300009545 | Unclassified | 651 |
| 73 | Ga0105238_10063539 | 3300009551 | Bacteria | 3692 |
| 74 | Ga0105238_10401758 | 3300009551 | Bacteria | 1363 |
| 75 | Ga0105238_10768580 | 3300009551 | Bacteria | 978 |
| 76 | Ga0105238_11638363 | 3300009551 | Unclassified | 674 |
| 77 | Ga0105249_11881130 | 3300009553 | Unclassified | 671 |
| 78 | Ga0105239_10080686 | 3300010375 | Bacteria | 3580 |
| 79 | Ga0105239_10895503 | 3300010375 | Unclassified | 1018 |
| 80 | Ga0157373_10526001 | 3300013100 | Unclassified | 856 |
| 81 | Ga0157370_10180642 | 3300013104 | Unclassified | 1961 |
| 82 | Ga0157374_10036618 | 3300013296 | Bacteria | 4495 |
| 83 | Ga0157378_10005362 | 3300013297 | Bacteria | 11249 |
| 84 | Ga0157378_10860878 | 3300013297 | Bacteria | 935 |
| 85 | Ga0163162_10775798 | 3300013306 | Bacteria | 1077 |
| 86 | Ga0157375_10574468 | 3300013308 | Unclassified | 1288 |
| 87 | Ga0157375_11941116 | 3300013308 | Unclassified | 699 |
| 88 | Ga0157375_11975790 | 3300013308 | Unclassified | 693 |
| 89 | Ga0163163_10045717 | 3300014325 | Unclassified | 4299 |
| 90 | Ga0163163_10048324 | 3300014325 | Unclassified | 4184 |
| 91 | Ga0163163_11488855 | 3300014325 | Bacteria | 738 |
| 92 | Ga0157379_10369951 | 3300014968 | Unclassified | 1314 |
| 93 | Ga0157376_10071426 | 3300014969 | Bacteria | 2950 |
| 94 | Ga0157376_10498367 | 3300014969 | Bacteria | 1196 |
| 95 | Ga0213875_10000024 | 3300021388 | Bacteria | 200333 |
| 96 | Ga0213875_10003537 | 3300021388 | Bacteria | 8877 |
| 97 | Ga0213875_10011714 | 3300021388 | Bacteria | 4353 |
| 98 | Ga0224712_10199803 | 3300022467 | Bacteria | 908 |
| 99 | Ga0207680_10263473 | 3300025903 | Bacteria | 1194 |
| 100 | Ga0207699_10108521 | 3300025906 | Bacteria | 1775 |
| 101 | Ga0207699_10159369 | 3300025906 | Bacteria | 1501 |
| 102 | Ga0207695_10927136 | 3300025913 | Unclassified | 750 |
| 103 | Ga0207693_10168111 | 3300025915 | Bacteria | 1727 |
| 104 | Ga0207693_10347080 | 3300025915 | Bacteria | 1162 |
| 105 | Ga0207663_10865173 | 3300025916 | Unclassified | 722 |
| 106 | Ga0207652_10569094 | 3300025921 | Bacteria | 1017 |
| 107 | Ga0207652_11717367 | 3300025921 | Unclassified | 532 |
| 108 | Ga0207694_10121571 | 3300025924 | Bacteria | 2085 |
| 109 | Ga0207700_10004808 | 3300025928 | Bacteria | 8018 |
| 110 | Ga0207664_10127039 | 3300025929 | Bacteria | 2142 |
| 111 | Ga0207670_11291154 | 3300025936 | Unclassified | 619 |
| 112 | Ga0207704_10193722 | 3300025938 | Bacteria | 1481 |
| 113 | Ga0207665_10291120 | 3300025939 | Bacteria | 1218 |
| 114 | Ga0207665_10395546 | 3300025939 | Unclassified | 1051 |
| 115 | Ga0207665_10724337 | 3300025939 | Bacteria | 783 |
| 116 | Ga0207711_11553936 | 3300025941 | Unclassified | 605 |
| 117 | Ga0207711_11604077 | 3300025941 | Unclassified | 594 |
| 118 | Ga0207661_10043023 | 3300025944 | Unclassified | 3564 |
| 119 | Ga0207677_10648956 | 3300026023 | Unclassified | 931 |
| 120 | Ga0207703_10069228 | 3300026035 | Viruses | 2910 |
| 121 | Ga0207703_11110564 | 3300026035 | Bacteria | 760 |
| 122 | Ga0207641_10249704 | 3300026088 | Bacteria | 1656 |
| 123 | Ga0207641_11441614 | 3300026088 | Bacteria | 690 |
| 124 | Ga0207648_10827975 | 3300026089 | Unclassified | 862 |
| 125 | Ga0207676_11313868 | 3300026095 | Unclassified | 718 |
| 126 | Ga0207674_10202184 | 3300026116 | Bacteria | 1936 |
| 127 | Ga0207698_10166874 | 3300026142 | Bacteria | 1933 |
| 128 | Ga0268266_12218614 | 3300028379 | Unclassified | 521 |
| 129 | Ga0268264_10234683 | 3300028381 | Bacteria | 1696 |
| 130 | Ga0265323_10000176 | 3300028653 | Bacteria | 38367 |
| 131 | Ga0265762_1002272 | 3300030760 | Bacteria | 3472 |
| 132 | Ga0265760_10367702 | 3300031090 | Unclassified | 516 |
| 133 | Ga0265330_10026748 | 3300031235 | Bacteria | 2608 |
| 134 | Ga0265331_10053356 | 3300031250 | Bacteria | 1929 |
| 135 | Ga0265316_10002585 | 3300031344 | Bacteria | 18691 |
| 136 | Ga0265316_10016399 | 3300031344 | Bacteria | 6427 |
| 137 | Ga0265316_10090983 | 3300031344 | Bacteria | 2328 |
| 138 | Ga0265316_10131673 | 3300031344 | Bacteria | 1883 |
| 139 | Ga0265316_10149187 | 3300031344 | Bacteria | 1752 |
| 140 | Ga0265316_10162726 | 3300031344 | Bacteria | 1668 |
| 141 | Ga0265342_10264900 | 3300031712 | Bacteria | 913 |
| 142 | Ga0307516_10919695 | 3300031730 | Unclassified | 542 |
| 143 | Ga0307406_10697368 | 3300031901 | Unclassified | 847 |
| 144 | Ga0316214_1034790 | 3300033545 | Unclassified | 718 |
| 145 | Ga0373934_0281792 | 3300035086 | Unclassified | 688 |
| 146 | Ga0373953_0011912 | 3300035117 | Bacteria | 3065 |
| 147 | Ga0373954_0495119 | 3300035118 | Bacteria | 605 |
| 148 | Ga0373957_0118663 | 3300035120 | Unclassified | 1070 |
| 149 | Ga0373943_0147494 | 3300035170 | Bacteria | 1272 |
| 150 | Ga0373955_0009445 | 3300035172 | Bacteria | 4567 |
| 151 | Ga0373924_0142782 | 3300035410 | Unclassified | 1045 |
| 152 | Ga0373927_0002875 | 3300035695 | Bacteria | 12538 |
| 153 | Ga0373927_0446286 | 3300035695 | Bacteria | 854 |
| 154 | Ga0373933_0234636 | 3300035724 | Bacteria | 1179 |
| 155 | Ga0373947_0004230 | 3300035725 | Bacteria | 8418 |
| 156 | Ga0373947_0279115 | 3300035725 | Bacteria | 1110 |
| 157 | Ga0373947_0622350 | 3300035725 | Unclassified | 736 |
| 158 | Ga0373937_0049161 | 3300036401 | Bacteria | 3862 |
| 159 | Ga0373937_0407759 | 3300036401 | Bacteria | 1290 |
| 160 | Ga0373937_1391927 | 3300036401 | Unclassified | 649 |
| 161 | Ga0373925_0000470 | 3300037068 | Bacteria | 40239 |
| 162 | Ga0373925_0825176 | 3300037068 | Bacteria | 764 |
| 163 | Ga0395900_1377256 | 3300037418 | Unclassified | 619 |
| 164 | Ga0395898_0960453 | 3300037466 | Unclassified | 791 |
| 165 | Ga0436364_0465037 | 3300037853 | Unclassified | 711 |
| 166 | Ga0436364_1081322 | 3300037853 | Bacteria | 1372 |
| 167 | Ga0436364_1169042 | 3300037853 | Bacteria | 9848 |
| 168 | Ga0436364_1265330 | 3300037853 | Bacteria | 89074 |
| 169 | Ga0436364_1321932 | 3300037853 | Bacteria | 3231 |
| 170 | Ga0436364_1349063 | 3300037853 | Unclassified | 1101 |
| 171 | Ga0436360_1258247 | 3300039438 | Bacteria | 886 |
| 172 | Ga0466963_0561980 | 3300044694 | Unclassified | 806 |
| 173 | Ga0451576_0943022 | 3300045051 | Unclassified | 905 |
| 174 | Ga0495580_0048763 | 3300046472 | Unclassified | 2996 |
| 175 | Ga0495662_0504753 | 3300046476 | Bacteria | 593 |
| 176 | Ga0495594_0820319 | 3300046499 | Bacteria | 524 |
| 177 | Ga0495628_0058449 | 3300046516 | Bacteria | 3030 |
| 178 | Ga0495628_0670783 | 3300046516 | Unclassified | 735 |
| 179 | Ga0495630_0971798 | 3300046517 | Bacteria | 646 |
| 180 | Ga0495652_0426886 | 3300046529 | Bacteria | 933 |
| 181 | Ga0495652_0463699 | 3300046529 | Unclassified | 885 |
| 182 | Ga0495665_0075612 | 3300046531 | Unclassified | 1773 |
| 183 | Ga0495665_0601323 | 3300046531 | Unclassified | 550 |
| 184 | Ga0495667_0092413 | 3300046559 | Bacteria | 1959 |
| 185 | Ga0495667_0138172 | 3300046559 | Unclassified | 1571 |
| 186 | Ga0495667_0292356 | 3300046559 | Bacteria | 1033 |
| 187 | Ga0495588_0311438 | 3300046674 | Bacteria | 828 |
| 188 | Ga0495623_0026648 | 3300046679 | Bacteria | 3719 |
| 189 | Ga0495623_0148416 | 3300046679 | Bacteria | 1388 |
| 190 | Ga0495623_0347900 | 3300046679 | Bacteria | 808 |
| 191 | Ga0495658_0832991 | 3300046683 | Bacteria | 590 |
| 192 | Ga0495624_0145773 | 3300046690 | Bacteria | 1449 |
| 193 | Ga0495675_0077592 | 3300047444 | Unclassified | 2093 |
| 194 | Ga0495684_0331903 | 3300047471 | Unclassified | 1084 |
| 195 | Ga0495602_0197376 | 3300048088 | Unclassified | 1538 |
| 196 | Ga0496102_0432707 | 3300048905 | Bacteria | 1235 |
| 197 | Ga0496102_1435990 | 3300048905 | Unclassified | 609 |
| 198 | Ga0496111_0001330 | 3300048914 | Bacteria | 13912 |
| 199 | Ga0496114_0609695 | 3300048917 | Bacteria | 962 |
| 200 | Ga0496115_0320373 | 3300048918 | Bacteria | 1268 |
| 201 | Ga0501298_065490 | 3300049521 | Bacteria | 776 |
| 202 | Ga0501040_0441204 | 3300049576 | Bacteria | 937 |
| 203 | Ga0501040_1417137 | 3300049576 | Unclassified | 504 |
| 204 | Ga0501075_0371870 | 3300049591 | Bacteria | 1089 |
| 205 | Ga0501081_0768845 | 3300049743 | Bacteria | 724 |
| 206 | Ga0501045_1011818 | 3300049824 | Bacteria | 609 |
| 207 | nmdc:mga05p37_360113_c1 | 3300050507 | Unclassified | 1710 |
| 208 | Ga0495612_0429690 | 3300053078 | Unclassified | 602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0432707 | Ga0496102_0432707_394_759 | 121 |
| 2 | 3300031901 | Ga0307406_10697368 | Ga0307406_106973682 | 126 |
| 3 | 3300014325 | Ga0163163_11488855 | Ga0163163_114888551 | 127 |
| 4 | 3300035695 | Ga0373927_0002875 | Ga0373927_0002875_2691_3086 | 127 |
| 5 | 3300005295 | Ga0065707_10467947 | Ga0065707_104679471 | 128 |
| 6 | 3300005329 | Ga0070683_101443365 | Ga0070683_1014433651 | 128 |
| 7 | 3300005340 | Ga0070689_100885165 | Ga0070689_1008851652 | 128 |
| 8 | 3300005364 | Ga0070673_100190313 | Ga0070673_1001903133 | 128 |
| 9 | 3300005365 | Ga0070688_100452231 | Ga0070688_1004522313 | 128 |
| 10 | 3300005455 | Ga0070663_100965584 | Ga0070663_1009655841 | 128 |
| 11 | 3300005458 | Ga0070681_10171594 | Ga0070681_101715943 | 128 |
| 12 | 3300005459 | Ga0068867_100580225 | Ga0068867_1005802253 | 128 |
| 13 | 3300005518 | Ga0070699_100088145 | Ga0070699_1000881453 | 128 |
| 14 | 3300005530 | Ga0070679_100108529 | Ga0070679_1001085291 | 128 |
| 15 | 3300005548 | Ga0070665_100082666 | Ga0070665_1000826664 | 128 |
| 16 | 3300005618 | Ga0068864_100163991 | Ga0068864_1001639912 | 128 |
| 17 | 3300005841 | Ga0068863_100184823 | Ga0068863_1001848232 | 128 |
| 18 | 3300005842 | Ga0068858_100031102 | Ga0068858_1000311026 | 128 |
| 19 | 3300005843 | Ga0068860_102321623 | Ga0068860_1023216231 | 128 |
| 20 | 3300006028 | Ga0070717_10017650 | Ga0070717_100176504 | 128 |
| 21 | 3300006028 | Ga0070717_10273561 | Ga0070717_102735612 | 128 |
| 22 | 3300006173 | Ga0070716_100183561 | Ga0070716_1001835612 | 128 |
| 23 | 3300006237 | Ga0097621_100423652 | Ga0097621_1004236522 | 128 |
| 24 | 3300006358 | Ga0068871_100578236 | Ga0068871_1005782362 | 128 |
| 25 | 3300009093 | Ga0105240_10127397 | Ga0105240_101273975 | 128 |
| 26 | 3300009147 | Ga0114129_10358914 | Ga0114129_103589142 | 128 |
| 27 | 3300009147 | Ga0114129_10415407 | Ga0114129_104154073 | 128 |
| 28 | 3300009177 | Ga0105248_10330661 | Ga0105248_103306612 | 128 |
| 29 | 3300009177 | Ga0105248_10568641 | Ga0105248_105686412 | 128 |
| 30 | 3300009551 | Ga0105238_10401758 | Ga0105238_104017584 | 128 |
| 31 | 3300009553 | Ga0105249_11881130 | Ga0105249_118811301 | 128 |
| 32 | 3300010375 | Ga0105239_10895503 | Ga0105239_108955031 | 128 |
| 33 | 3300013104 | Ga0157370_10180642 | Ga0157370_101806422 | 128 |
| 34 | 3300013306 | Ga0163162_10775798 | Ga0163162_107757982 | 128 |
| 35 | 3300013308 | Ga0157375_10574468 | Ga0157375_105744682 | 128 |
| 36 | 3300013308 | Ga0157375_11941116 | Ga0157375_119411162 | 128 |
| 37 | 3300014325 | Ga0163163_10045717 | Ga0163163_100457173 | 128 |
| 38 | 3300014325 | Ga0163163_10048324 | Ga0163163_100483244 | 128 |
| 39 | 3300014968 | Ga0157379_10369951 | Ga0157379_103699512 | 128 |
| 40 | 3300014969 | Ga0157376_10071426 | Ga0157376_100714263 | 128 |
| 41 | 3300014969 | Ga0157376_10498367 | Ga0157376_104983673 | 128 |
| 42 | 3300021388 | Ga0213875_10000024 | Ga0213875_10000024162 | 128 |
| 43 | 3300021388 | Ga0213875_10003537 | Ga0213875_100035373 | 128 |
| 44 | 3300021388 | Ga0213875_10011714 | Ga0213875_100117145 | 128 |
| 45 | 3300022467 | Ga0224712_10199803 | Ga0224712_101998032 | 128 |
| 46 | 3300025903 | Ga0207680_10263473 | Ga0207680_102634733 | 128 |
| 47 | 3300025921 | Ga0207652_10569094 | Ga0207652_105690943 | 128 |
| 48 | 3300025936 | Ga0207670_11291154 | Ga0207670_112911542 | 128 |
| 49 | 3300025939 | Ga0207665_10724337 | Ga0207665_107243371 | 128 |
| 50 | 3300025941 | Ga0207711_11553936 | Ga0207711_115539361 | 128 |
| 51 | 3300025941 | Ga0207711_11604077 | Ga0207711_116040771 | 128 |
| 52 | 3300025944 | Ga0207661_10043023 | Ga0207661_100430233 | 128 |
| 53 | 3300026035 | Ga0207703_10069228 | Ga0207703_100692283 | 128 |
| 54 | 3300026088 | Ga0207641_10249704 | Ga0207641_102497042 | 128 |
| 55 | 3300026088 | Ga0207641_11441614 | Ga0207641_114416142 | 128 |
| 56 | 3300026089 | Ga0207648_10827975 | Ga0207648_108279751 | 128 |
| 57 | 3300026095 | Ga0207676_11313868 | Ga0207676_113138681 | 128 |
| 58 | 3300028379 | Ga0268266_12218614 | Ga0268266_122186141 | 128 |
| 59 | 3300028653 | Ga0265323_10000176 | Ga0265323_1000017625 | 128 |
| 60 | 3300031090 | Ga0265760_10367702 | Ga0265760_103677021 | 128 |
| 61 | 3300031235 | Ga0265330_10026748 | Ga0265330_100267483 | 128 |
| 62 | 3300031250 | Ga0265331_10053356 | Ga0265331_100533564 | 128 |
| 63 | 3300031344 | Ga0265316_10002585 | Ga0265316_1000258515 | 128 |
| 64 | 3300031344 | Ga0265316_10016399 | Ga0265316_100163994 | 128 |
| 65 | 3300031344 | Ga0265316_10090983 | Ga0265316_100909832 | 128 |
| 66 | 3300031344 | Ga0265316_10131673 | Ga0265316_101316732 | 128 |
| 67 | 3300031344 | Ga0265316_10149187 | Ga0265316_101491872 | 128 |
| 68 | 3300031344 | Ga0265316_10162726 | Ga0265316_101627262 | 128 |
| 69 | 3300031712 | Ga0265342_10264900 | Ga0265342_102649003 | 128 |
| 70 | 3300035117 | Ga0373953_0011912 | Ga0373953_0011912_520_912 | 128 |
| 71 | 3300035118 | Ga0373954_0495119 | Ga0373954_0495119_96_488 | 128 |
| 72 | 3300035170 | Ga0373943_0147494 | Ga0373943_0147494_701_1093 | 128 |
| 73 | 3300035172 | Ga0373955_0009445 | Ga0373955_0009445_787_1179 | 128 |
| 74 | 3300035695 | Ga0373927_0446286 | Ga0373927_0446286_261_653 | 128 |
| 75 | 3300035725 | Ga0373947_0004230 | Ga0373947_0004230_1788_2180 | 128 |
| 76 | 3300035725 | Ga0373947_0279115 | Ga0373947_0279115_149_541 | 128 |
| 77 | 3300035725 | Ga0373947_0622350 | Ga0373947_0622350_137_529 | 128 |
| 78 | 3300036401 | Ga0373937_0049161 | Ga0373937_0049161_2632_3024 | 128 |
| 79 | 3300037068 | Ga0373925_0000470 | Ga0373925_0000470_6254_6646 | 128 |
| 80 | 3300037068 | Ga0373925_0825176 | Ga0373925_0825176_222_614 | 128 |
| 81 | 3300037466 | Ga0395898_0960453 | Ga0395898_0960453_256_729 | 128 |
| 82 | 3300037853 | Ga0436364_0465037 | Ga0436364_0465037_273_662 | 128 |
| 83 | 3300037853 | Ga0436364_1081322 | Ga0436364_1081322_533_922 | 128 |
| 84 | 3300037853 | Ga0436364_1169042 | Ga0436364_1169042_2002_2403 | 128 |
| 85 | 3300037853 | Ga0436364_1265330 | Ga0436364_1265330_65137_65529 | 128 |
| 86 | 3300037853 | Ga0436364_1321932 | Ga0436364_1321932_1864_2256 | 128 |
| 87 | 3300037853 | Ga0436364_1349063 | Ga0436364_1349063_606_1007 | 128 |
| 88 | 3300039438 | Ga0436360_1258247 | Ga0436360_1258247_208_600 | 128 |
| 89 | 3300044694 | Ga0466963_0561980 | Ga0466963_0561980_232_633 | 128 |
| 90 | 3300045051 | Ga0451576_0943022 | Ga0451576_0943022_345_737 | 128 |
| 91 | 3300046472 | Ga0495580_0048763 | Ga0495580_0048763_870_1262 | 128 |
| 92 | 3300046476 | Ga0495662_0504753 | Ga0495662_0504753_111_500 | 128 |
| 93 | 3300046499 | Ga0495594_0820319 | Ga0495594_0820319_100_489 | 128 |
| 94 | 3300046516 | Ga0495628_0058449 | Ga0495628_0058449_2041_2433 | 128 |
| 95 | 3300046516 | Ga0495628_0670783 | Ga0495628_0670783_182_583 | 128 |
| 96 | 3300046517 | Ga0495630_0971798 | Ga0495630_0971798_77_466 | 128 |
| 97 | 3300046529 | Ga0495652_0426886 | Ga0495652_0426886_410_802 | 128 |
| 98 | 3300046529 | Ga0495652_0463699 | Ga0495652_0463699_112_513 | 128 |
| 99 | 3300046531 | Ga0495665_0075612 | Ga0495665_0075612_259_651 | 128 |
| 100 | 3300046559 | Ga0495667_0092413 | Ga0495667_0092413_1165_1557 | 128 |
| 101 | 3300046559 | Ga0495667_0138172 | Ga0495667_0138172_70_462 | 128 |
| 102 | 3300046559 | Ga0495667_0292356 | Ga0495667_0292356_615_1007 | 128 |
| 103 | 3300046674 | Ga0495588_0311438 | Ga0495588_0311438_164_556 | 128 |
| 104 | 3300046679 | Ga0495623_0026648 | Ga0495623_0026648_3293_3685 | 128 |
| 105 | 3300046679 | Ga0495623_0347900 | Ga0495623_0347900_341_733 | 128 |
| 106 | 3300046683 | Ga0495658_0832991 | Ga0495658_0832991_56_448 | 128 |
| 107 | 3300046690 | Ga0495624_0145773 | Ga0495624_0145773_395_787 | 128 |
| 108 | 3300047471 | Ga0495684_0331903 | Ga0495684_0331903_606_998 | 128 |
| 109 | 3300048917 | Ga0496114_0609695 | Ga0496114_0609695_383_772 | 128 |
| 110 | 3300048918 | Ga0496115_0320373 | Ga0496115_0320373_638_1030 | 128 |
| 111 | 3300049521 | Ga0501298_065490 | Ga0501298_065490_214_606 | 128 |
| 112 | 3300049576 | Ga0501040_0441204 | Ga0501040_0441204_408_800 | 128 |
| 113 | 3300049576 | Ga0501040_1417137 | Ga0501040_1417137_69_461 | 128 |
| 114 | 3300049591 | Ga0501075_0371870 | Ga0501075_0371870_430_822 | 128 |
| 115 | 3300049743 | Ga0501081_0768845 | Ga0501081_0768845_105_497 | 128 |
| 116 | 3300049824 | Ga0501045_1011818 | Ga0501045_1011818_104_496 | 128 |
| 117 | 3300050507 | nmdc:mga05p37_360113_c1 | nmdc:mga05p37_360113_c1_342_734 | 128 |
| 118 | 3300005366 | Ga0070659_101478822 | Ga0070659_1014788221 | 129 |
| 119 | 3300031730 | Ga0307516_10919695 | Ga0307516_109196951 | 129 |
| 120 | 3300000546 | LJNas_1000083 | LJNas_10000833 | 130 |
| 121 | 3300005329 | Ga0070683_100171525 | Ga0070683_1001715251 | 130 |
| 122 | 3300005338 | Ga0068868_100048469 | Ga0068868_1000484694 | 130 |
| 123 | 3300005365 | Ga0070688_101080476 | Ga0070688_1010804761 | 130 |
| 124 | 3300005366 | Ga0070659_101311306 | Ga0070659_1013113061 | 130 |
| 125 | 3300005434 | Ga0070709_10070825 | Ga0070709_100708253 | 130 |
| 126 | 3300005434 | Ga0070709_10079255 | Ga0070709_100792553 | 130 |
| 127 | 3300005434 | Ga0070709_10713980 | Ga0070709_107139801 | 130 |
| 128 | 3300005434 | Ga0070709_11049401 | Ga0070709_110494012 | 130 |
| 129 | 3300005435 | Ga0070714_100249198 | Ga0070714_1002491982 | 130 |
| 130 | 3300005436 | Ga0070713_100033714 | Ga0070713_1000337142 | 130 |
| 131 | 3300005437 | Ga0070710_10112331 | Ga0070710_101123312 | 130 |
| 132 | 3300005439 | Ga0070711_100356249 | Ga0070711_1003562492 | 130 |
| 133 | 3300005458 | Ga0070681_10020870 | Ga0070681_100208704 | 130 |
| 134 | 3300005458 | Ga0070681_10874783 | Ga0070681_108747832 | 130 |
| 135 | 3300005466 | Ga0070685_10285958 | Ga0070685_102859582 | 130 |
| 136 | 3300005467 | Ga0070706_100187300 | Ga0070706_1001873004 | 130 |
| 137 | 3300005530 | Ga0070679_100921789 | Ga0070679_1009217891 | 130 |
| 138 | 3300005535 | Ga0070684_100028437 | Ga0070684_1000284372 | 130 |
| 139 | 3300005536 | Ga0070697_101088085 | Ga0070697_1010880851 | 130 |
| 140 | 3300005539 | Ga0068853_100900863 | Ga0068853_1009008632 | 130 |
| 141 | 3300005544 | Ga0070686_101294810 | Ga0070686_1012948101 | 130 |
| 142 | 3300005548 | Ga0070665_100023533 | Ga0070665_1000235331 | 130 |
| 143 | 3300005616 | Ga0068852_100314348 | Ga0068852_1003143483 | 130 |
| 144 | 3300005834 | Ga0068851_10104826 | Ga0068851_101048262 | 130 |
| 145 | 3300005841 | Ga0068863_101454416 | Ga0068863_1014544161 | 130 |
| 146 | 3300006028 | Ga0070717_10340447 | Ga0070717_103404472 | 130 |
| 147 | 3300006028 | Ga0070717_10714222 | Ga0070717_107142222 | 130 |
| 148 | 3300006028 | Ga0070717_11139399 | Ga0070717_111393991 | 130 |
| 149 | 3300006173 | Ga0070716_100138220 | Ga0070716_1001382205 | 130 |
| 150 | 3300006173 | Ga0070716_100964377 | Ga0070716_1009643771 | 130 |
| 151 | 3300006175 | Ga0070712_100162583 | Ga0070712_1001625832 | 130 |
| 152 | 3300006175 | Ga0070712_100586544 | Ga0070712_1005865441 | 130 |
| 153 | 3300006175 | Ga0070712_100815814 | Ga0070712_1008158142 | 130 |
| 154 | 3300006237 | Ga0097621_101157912 | Ga0097621_1011579121 | 130 |
| 155 | 3300006914 | Ga0075436_100082269 | Ga0075436_1000822694 | 130 |
| 156 | 3300007076 | Ga0075435_100518786 | Ga0075435_1005187863 | 130 |
| 157 | 3300009093 | Ga0105240_10702472 | Ga0105240_107024723 | 130 |
| 158 | 3300009098 | Ga0105245_12731155 | Ga0105245_127311551 | 130 |
| 159 | 3300009098 | Ga0105245_12740520 | Ga0105245_127405201 | 130 |
| 160 | 3300009148 | Ga0105243_12349008 | Ga0105243_123490082 | 130 |
| 161 | 3300009174 | Ga0105241_10008117 | Ga0105241_100081178 | 130 |
| 162 | 3300009174 | Ga0105241_10113061 | Ga0105241_101130614 | 130 |
| 163 | 3300009174 | Ga0105241_10878651 | Ga0105241_108786512 | 130 |
| 164 | 3300009177 | Ga0105248_10201087 | Ga0105248_102010872 | 130 |
| 165 | 3300009545 | Ga0105237_11633649 | Ga0105237_116336492 | 130 |
| 166 | 3300009551 | Ga0105238_10063539 | Ga0105238_100635391 | 130 |
| 167 | 3300009551 | Ga0105238_10768580 | Ga0105238_107685802 | 130 |
| 168 | 3300009551 | Ga0105238_11638363 | Ga0105238_116383632 | 130 |
| 169 | 3300010375 | Ga0105239_10080686 | Ga0105239_100806864 | 130 |
| 170 | 3300013100 | Ga0157373_10526001 | Ga0157373_105260011 | 130 |
| 171 | 3300013296 | Ga0157374_10036618 | Ga0157374_100366186 | 130 |
| 172 | 3300013297 | Ga0157378_10005362 | Ga0157378_100053625 | 130 |
| 173 | 3300013297 | Ga0157378_10860878 | Ga0157378_108608782 | 130 |
| 174 | 3300013308 | Ga0157375_11975790 | Ga0157375_119757901 | 130 |
| 175 | 3300025906 | Ga0207699_10108521 | Ga0207699_101085214 | 130 |
| 176 | 3300025906 | Ga0207699_10159369 | Ga0207699_101593692 | 130 |
| 177 | 3300025913 | Ga0207695_10927136 | Ga0207695_109271362 | 130 |
| 178 | 3300025915 | Ga0207693_10168111 | Ga0207693_101681114 | 130 |
| 179 | 3300025915 | Ga0207693_10347080 | Ga0207693_103470803 | 130 |
| 180 | 3300025916 | Ga0207663_10865173 | Ga0207663_108651732 | 130 |
| 181 | 3300025921 | Ga0207652_11717367 | Ga0207652_117173671 | 130 |
| 182 | 3300025924 | Ga0207694_10121571 | Ga0207694_101215713 | 130 |
| 183 | 3300025928 | Ga0207700_10004808 | Ga0207700_100048087 | 130 |
| 184 | 3300025929 | Ga0207664_10127039 | Ga0207664_101270394 | 130 |
| 185 | 3300025938 | Ga0207704_10193722 | Ga0207704_101937222 | 130 |
| 186 | 3300025939 | Ga0207665_10291120 | Ga0207665_102911201 | 130 |
| 187 | 3300025939 | Ga0207665_10395546 | Ga0207665_103955463 | 130 |
| 188 | 3300026023 | Ga0207677_10648956 | Ga0207677_106489562 | 130 |
| 189 | 3300026035 | Ga0207703_11110564 | Ga0207703_111105642 | 130 |
| 190 | 3300026116 | Ga0207674_10202184 | Ga0207674_102021841 | 130 |
| 191 | 3300026142 | Ga0207698_10166874 | Ga0207698_101668742 | 130 |
| 192 | 3300028381 | Ga0268264_10234683 | Ga0268264_102346833 | 130 |
| 193 | 3300030760 | Ga0265762_1002272 | Ga0265762_10022724 | 130 |
| 194 | 3300033545 | Ga0316214_1034790 | Ga0316214_10347902 | 130 |
| 195 | 3300035086 | Ga0373934_0281792 | Ga0373934_0281792_247_639 | 130 |
| 196 | 3300035120 | Ga0373957_0118663 | Ga0373957_0118663_638_1030 | 130 |
| 197 | 3300035410 | Ga0373924_0142782 | Ga0373924_0142782_59_451 | 130 |
| 198 | 3300035724 | Ga0373933_0234636 | Ga0373933_0234636_345_737 | 130 |
| 199 | 3300036401 | Ga0373937_0407759 | Ga0373937_0407759_206_598 | 130 |
| 200 | 3300036401 | Ga0373937_1391927 | Ga0373937_1391927_191_583 | 130 |
| 201 | 3300037418 | Ga0395900_1377256 | Ga0395900_1377256_65_457 | 130 |
| 202 | 3300046531 | Ga0495665_0601323 | Ga0495665_0601323_43_435 | 130 |
| 203 | 3300046679 | Ga0495623_0148416 | Ga0495623_0148416_213_605 | 130 |
| 204 | 3300047444 | Ga0495675_0077592 | Ga0495675_0077592_288_680 | 130 |
| 205 | 3300048088 | Ga0495602_0197376 | Ga0495602_0197376_794_1186 | 130 |
| 206 | 3300048905 | Ga0496102_1435990 | Ga0496102_1435990_21_413 | 130 |
| 207 | 3300048914 | Ga0496111_0001330 | Ga0496111_0001330_12912_13304 | 130 |
| 208 | 3300053078 | Ga0495612_0429690 | Ga0495612_0429690_73_465 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6yef-assembly1.cif.gz_t | 70s initiation complex with assigned rrna modifications from staphylococcus aureus | 0.9262 | 37 | 69 |
| 7p7r-assembly1.cif.gz_u | poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state i | 0.9252 | 39 | 70 |
| 7boe-assembly1.cif.gz_T | bacterial 30s ribosomal subunit assembly complex state m (consensus refinement) | 0.9146 | 39 | 70 |
| 3vmq-assembly1.cif.gz_A | crystal structure of staphylococcus aureus membrane-bound transglycosylase: apoenzyme | 0.9124 | 37 | 68 |
| 3ue1-assembly1.cif.gz_A | crystal strucuture of acinetobacter baumanni pbp1a in complex with mc-1 | 0.9113 | 37 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76577_56_250_1.10.3810.10 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9871 | 39 | 66 | 1.10.3810.10 |
| af_P9WFA3_1_120_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9768 | 1 | 122 | 3.40.50.1010 |
| af_P9WFA3_1_120_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9689 | 1 | 122 | 3.40.50.1010 |
| 5zeut00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9659 | 39 | 69 | 1.20.58.110 |
| af_P9WFA9_1_117_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9452 | 1 | 122 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M8SWL0-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9949 | 1 | 130 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A6N7W7T3-F1-model_v4 | Type II toxin-antitoxin system VapC family toxin | 0.9817 | 1 | 129 |
GO:0004518
|
| AF-A0A7V9L908-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9816 | 1 | 130 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A536JKL2-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9779 | 1 | 130 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A0A0JA68-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9775 | 2 | 130 |
GO:0000287
GO:0004540 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar