F317544

General Info

Members Datasets Scaffolds Average Seq Length
208 142 416 117

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100641106|Ga0070704_1006411062
Length 118
Sequence MLGLHQANAVLLILTNLLAFGWGVSYLLRKRYPGRVYAHILAAGQALLIAQVALGLLLLSDGRRAPDHLHYLYGALALFAALTPWLYAPPVPARRLTWFVGATLFATALSVRAYLTAT

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
62 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
63 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
66 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
69 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
70 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
71 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
72 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
73 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
74 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
75 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
76 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100641106 3300005549 Bacteria 937
2 Ga0070680_101000705 3300005336 Bacteria 722
3 Ga0070689_101851775 3300005340 Bacteria 551
4 Ga0070674_100496365 3300005356 Bacteria 1016
5 Ga0070710_10471123 3300005437 Bacteria 855
6 Ga0070701_10028687 3300005438 Bacteria 2737
7 Ga0070711_100812454 3300005439 Bacteria 794
8 Ga0070700_100162729 3300005441 Unclassified 1538
9 Ga0070694_101683890 3300005444 Bacteria 539
10 Ga0070708_100647371 3300005445 Bacteria 996
11 Ga0070678_100728238 3300005456 Bacteria 895
12 Ga0068867_101000500 3300005459 Bacteria 758
13 Ga0070706_100324741 3300005467 Bacteria 1435
14 Ga0070707_100561406 3300005468 Bacteria 1104
15 Ga0070707_101165403 3300005468 Bacteria 737
16 Ga0070698_100284890 3300005471 Bacteria 1583
17 Ga0070698_100612053 3300005471 Bacteria 1030
18 Ga0070672_100951812 3300005543 Bacteria 760
19 Ga0070665_100150806 3300005548 Unclassified 2328
20 Ga0068864_101998057 3300005618 Bacteria 586
21 Ga0068870_10465487 3300005840 Bacteria 836
22 Ga0068863_101489264 3300005841 Bacteria 685
23 Ga0081538_10017342 3300005981 Bacteria 5469
24 Ga0081539_10006131 3300005985 Bacteria 11710
25 Ga0070717_11895281 3300006028 Bacteria 538
26 Ga0068871_101938499 3300006358 Bacteria 560
27 Ga0068865_100514340 3300006881 Bacteria 1000
28 Ga0111539_10041447 3300009094 Bacteria 5536
29 Ga0111539_10631608 3300009094 Bacteria 1247
30 Ga0105245_10046349 3300009098 Unclassified 3885
31 Ga0114129_10427961 3300009147 Bacteria 1740
32 Ga0114129_11304439 3300009147 Unclassified 900
33 Ga0105243_10630245 3300009148 Bacteria 1036
34 Ga0105242_10473867 3300009176 Bacteria 1185
35 Ga0105239_11490591 3300010375 Bacteria 782
36 Ga0157374_11385551 3300013296 Bacteria 726
37 Ga0163163_10296367 3300014325 Bacteria 1670
38 Ga0163163_12012177 3300014325 Bacteria 637
39 Ga0157380_13379252 3300014326 Bacteria 511
40 Ga0182008_10426015 3300014497 Bacteria 717
41 Ga0207692_10326629 3300025898 Bacteria 940
42 Ga0207705_11036629 3300025909 Bacteria 633
43 Ga0207684_10369515 3300025910 Bacteria 1234
44 Ga0207684_10634476 3300025910 Bacteria 911
45 Ga0207646_10382741 3300025922 Bacteria 1271
46 Ga0207646_10972926 3300025922 Bacteria 751
47 Ga0207659_10413295 3300025926 Unclassified 1130
48 Ga0207686_11644952 3300025934 Bacteria 531
49 Ga0207709_10364292 3300025935 Bacteria 1095
50 Ga0207669_10570450 3300025937 Unclassified 916
51 Ga0207704_11237801 3300025938 Bacteria 637
52 Ga0207691_10093738 3300025940 Bacteria 2687
53 Ga0207679_10809580 3300025945 Unclassified 854
54 Ga0207708_10184222 3300026075 Unclassified 1659
55 Ga0207683_10089176 3300026121 Archaea 2744
56 Ga0207428_10262077 3300027907 Bacteria 1287
57 Ga0307408_100396580 3300031548 Bacteria 1184
58 Ga0307408_100415097 3300031548 Bacteria 1159
59 Ga0307408_100781762 3300031548 Bacteria 865
60 Ga0307409_100299978 3300031995 Bacteria 1494
61 Ga0307409_101162488 3300031995 Unclassified 794
62 Ga0307409_101632737 3300031995 Bacteria 673
63 Ga0307416_100031868 3300032002 Bacteria 3975
64 Ga0307416_100143359 3300032002 Bacteria 2176
65 Ga0307416_100483412 3300032002 Bacteria 1299
66 Ga0307416_101019012 3300032002 Unclassified 931
67 Ga0307414_11100207 3300032004 Unclassified 734
68 Ga0307411_11318966 3300032005 Unclassified 658
69 Ga0395899_0004304 3300037312 Bacteria 11119
70 Ga0395899_0008915 3300037312 Bacteria 7722
71 Ga0395899_0031616 3300037312 Bacteria 3978
72 Ga0395899_0095959 3300037312 Bacteria 2145
73 Ga0395900_0044800 3300037418 Unclassified 4557
74 Ga0395900_0100506 3300037418 Bacteria 2971
75 Ga0395898_0008715 3300037466 Bacteria 10700
76 Ga0395898_0020023 3300037466 Bacteria 6801
77 Ga0395898_0050440 3300037466 Bacteria 4072
78 Ga0395898_0051078 3300037466 Bacteria 4044
79 Ga0395898_0511977 3300037466 Bacteria 1141
80 Ga0395898_0815755 3300037466 Bacteria 873
81 Ga0395905_0012487 3300037471 Bacteria 8176
82 Ga0395905_0020599 3300037471 Bacteria 6244
83 Ga0395905_0284289 3300037471 Bacteria 1541
84 Ga0395905_0480751 3300037471 Bacteria 1141
85 Ga0395905_0630401 3300037471 Unclassified 974
86 Ga0395901_0007318 3300038443 Bacteria 11142
87 Ga0395901_0016696 3300038443 Bacteria 7480
88 Ga0395901_0101102 3300038443 Bacteria 3025
89 Ga0395901_0206353 3300038443 Bacteria 2058
90 Ga0395901_0366233 3300038443 Bacteria 1485
91 Ga0395901_0704053 3300038443 Unclassified 1007
92 Ga0395901_0967114 3300038443 Bacteria 829
93 Ga0439436_0022551 3300041404 Bacteria 1865
94 Ga0439447_032761 3300041407 Bacteria 1298
95 Ga0439453_0054488 3300041408 Unclassified 815
96 Ga0439461_0001313 3300041410 Bacteria 3819
97 Ga0439461_0016878 3300041410 Bacteria 1413
98 Ga0439466_0112624 3300041411 Unclassified 843
99 Ga0439465_0253944 3300041413 Bacteria 651
100 Ga0439465_0350446 3300041413 Unclassified 557
101 Ga0439465_0390403 3300041413 Bacteria 529
102 Ga0451841_0983949 3300041498 Unclassified 500
103 Ga0451853_1264267 3300041512 Bacteria 576
104 Ga0439442_013079 3300042002 Bacteria 1702
105 Ga0439442_013356 3300042002 Bacteria 1684
106 Ga0439445_0017161 3300042004 Bacteria 1788
107 Ga0439445_0027210 3300042004 Bacteria 1468
108 Ga0439445_0036481 3300042004 Bacteria 1294
109 Ga0439432_052922 3300042006 Bacteria 1263
110 Ga0439462_0007425 3300042015 Bacteria 2743
111 Ga0450914_040911 3300042118 Unclassified 588
112 Ga0450920_061387 3300042122 Unclassified 759
113 Ga0450910_081016 3300042147 Bacteria 567
114 Ga0450910_098256 3300042147 Unclassified 524
115 Ga0439446_0001153 3300042156 Bacteria 5867
116 Ga0439446_0005059 3300042156 Bacteria 3374
117 Ga0450909_031212 3300042185 Bacteria 809
118 Ga0439434_0010805 3300042435 Bacteria 2694
119 Ga0439434_0024402 3300042435 Bacteria 1824
120 Ga0439434_0057228 3300042435 Bacteria 1215
121 Ga0439459_0178027 3300042438 Bacteria 570
122 Ga0439460_0354264 3300042461 Bacteria 518
123 Ga0450918_028040 3300042531 Unclassified 991
124 Ga0466963_1192916 3300044694 Unclassified 535
125 Ga0466960_0263595 3300044901 Unclassified 961
126 Ga0451576_1726508 3300045051 Bacteria 648
127 Ga0466967_0892663 3300045976 Bacteria 884
128 Ga0495641_0467836 3300046461 Bacteria 574
129 Ga0495605_0297682 3300046474 Unclassified 683
130 Ga0495584_0649073 3300046491 Bacteria 538
131 Ga0495607_0199950 3300046501 Unclassified 990
132 Ga0495620_0193936 3300046515 Bacteria 783
133 Ga0495628_0476524 3300046516 Unclassified 904
134 Ga0495644_0050600 3300046523 Bacteria 1560
135 Ga0495640_0293063 3300046533 Bacteria 1012
136 Ga0495609_0320258 3300046538 Bacteria 629
137 Ga0495633_0274186 3300046558 Bacteria 768
138 Ga0495667_0089601 3300046559 Bacteria 1994
139 Ga0495656_0066742 3300046615 Bacteria 1586
140 Ga0495656_0106216 3300046615 Unclassified 1306
141 Ga0495656_0126079 3300046615 Bacteria 1214
142 Ga0495634_0117570 3300046642 Bacteria 1705
143 Ga0495635_0002676 3300046663 Bacteria 12172
144 Ga0495661_0290074 3300046665 Bacteria 822
145 Ga0495670_0062342 3300046691 Bacteria 1876
146 Ga0495670_0212152 3300046691 Unclassified 1027
147 Ga0495589_0302087 3300046794 Bacteria 742
148 Ga0495600_0700664 3300046809 Unclassified 609
149 Ga0495636_0677392 3300047318 Unclassified 508
150 Ga0495674_0052650 3300047319 Bacteria 3581
151 Ga0495674_0858131 3300047319 Bacteria 703
152 Ga0495680_0053436 3300047322 Bacteria 3143
153 Ga0495677_0269128 3300047445 Bacteria 668
154 Ga0495684_0727643 3300047471 Bacteria 655
155 Ga0496104_0283762 3300048907 Bacteria 1569
156 Ga0496105_0380083 3300048908 Bacteria 1124
157 Ga0496105_1163332 3300048908 Unclassified 570
158 Ga0496108_1578787 3300048911 Unclassified 544
159 Ga0496110_0523344 3300048913 Bacteria 1079
160 Ga0496111_0158535 3300048914 Bacteria 1680
161 Ga0496111_1104357 3300048914 Bacteria 565
162 Ga0496112_1139268 3300048915 Bacteria 698
163 Ga0501031_0748434 3300049568 Bacteria 627
164 Ga0501036_1726394 3300049572 Bacteria 504
165 Ga0501038_0745927 3300049574 Bacteria 731
166 Ga0501038_1319818 3300049574 Bacteria 520
167 Ga0501040_0347801 3300049576 Bacteria 1062
168 Ga0501040_0373167 3300049576 Bacteria 1023
169 Ga0501041_0216284 3300049577 Bacteria 1202
170 Ga0501042_0088134 3300049578 Bacteria 2227
171 Ga0501042_0196223 3300049578 Bacteria 1456
172 Ga0501042_0527227 3300049578 Bacteria 858
173 Ga0501046_0755383 3300049580 Viruses 683
174 Ga0501048_1342219 3300049582 Bacteria 514
175 Ga0501070_0781043 3300049586 Bacteria 751
176 Ga0501071_0175862 3300049587 Bacteria 1603
177 Ga0501071_0539224 3300049587 Bacteria 896
178 Ga0501071_1100604 3300049587 Bacteria 614
179 Ga0501072_0077366 3300049588 Bacteria 2634
180 Ga0501072_1180348 3300049588 Bacteria 595
181 Ga0501073_0882798 3300049589 Bacteria 616
182 Ga0501074_0498178 3300049590 Bacteria 863
183 Ga0501074_0884747 3300049590 Bacteria 629
184 Ga0501075_0069663 3300049591 Bacteria 2658
185 Ga0501075_0520054 3300049591 Bacteria 908
186 Ga0501076_0238043 3300049592 Bacteria 1489
187 Ga0501076_0595375 3300049592 Unclassified 912
188 Ga0501076_0662377 3300049592 Bacteria 861
189 Ga0501077_0281736 3300049593 Bacteria 1058
190 Ga0501077_0597347 3300049593 Bacteria 709
191 Ga0501080_1355088 3300049742 Bacteria 608
192 Ga0501081_0464128 3300049743 Bacteria 941
193 Ga0501044_1101774 3300049823 Bacteria 663
194 Ga0501045_0217113 3300049824 Bacteria 1424
195 Ga0501045_0293916 3300049824 Bacteria 1209
196 nmdc:mga05p37_1020462_c1 3300050507 Unclassified 876
197 nmdc:mga05p37_381906_c1 3300050507 Bacteria 1650
198 nmdc:mga08y16_18173_c1 3300050511 Bacteria 7408
199 nmdc:mga0a205_251581_c1 3300050515 Bacteria 1646
200 Ga0495595_0042676 3300053084 Bacteria 2078
201 Ga0495619_0490637 3300053085 Bacteria 845
202 Ga0501084_0089746 3300054114 Bacteria 2580
203 Ga0501084_0319052 3300054114 Bacteria 1312
204 Ga0590075_061507 3300059424 Unclassified 968
205 Ga0501082_0372068 3300060353 Bacteria 1246
206 Ga0501082_1456816 3300060353 Bacteria 598
207 Ga0530510_0722160 3300061734 Viruses 759
208 Ga0530510_0903537 3300061734 Unclassified 675
209 Ga0070704_100641106
210 Ga0070680_101000705
211 Ga0070689_101851775
212 Ga0070674_100496365
213 Ga0070710_10471123
214 Ga0070701_10028687
215 Ga0070711_100812454
216 Ga0070700_100162729
217 Ga0070694_101683890
218 Ga0070708_100647371
219 Ga0070678_100728238
220 Ga0068867_101000500
221 Ga0070706_100324741
222 Ga0070707_100561406
223 Ga0070707_101165403
224 Ga0070698_100284890
225 Ga0070698_100612053
226 Ga0070672_100951812
227 Ga0070665_100150806
228 Ga0068864_101998057
229 Ga0068870_10465487
230 Ga0068863_101489264
231 Ga0081538_10017342
232 Ga0081539_10006131
233 Ga0070717_11895281
234 Ga0068871_101938499
235 Ga0068865_100514340
236 Ga0111539_10041447
237 Ga0111539_10631608
238 Ga0105245_10046349
239 Ga0114129_10427961
240 Ga0114129_11304439
241 Ga0105243_10630245
242 Ga0105242_10473867
243 Ga0105239_11490591
244 Ga0157374_11385551
245 Ga0163163_10296367
246 Ga0163163_12012177
247 Ga0157380_13379252
248 Ga0182008_10426015
249 Ga0207692_10326629
250 Ga0207705_11036629
251 Ga0207684_10369515
252 Ga0207684_10634476
253 Ga0207646_10382741
254 Ga0207646_10972926
255 Ga0207659_10413295
256 Ga0207686_11644952
257 Ga0207709_10364292
258 Ga0207669_10570450
259 Ga0207704_11237801
260 Ga0207691_10093738
261 Ga0207679_10809580
262 Ga0207708_10184222
263 Ga0207683_10089176
264 Ga0207428_10262077
265 Ga0307408_100396580
266 Ga0307408_100415097
267 Ga0307408_100781762
268 Ga0307409_100299978
269 Ga0307409_101162488
270 Ga0307409_101632737
271 Ga0307416_100031868
272 Ga0307416_100143359
273 Ga0307416_100483412
274 Ga0307416_101019012
275 Ga0307414_11100207
276 Ga0307411_11318966
277 Ga0395899_0004304
278 Ga0395899_0008915
279 Ga0395899_0031616
280 Ga0395899_0095959
281 Ga0395900_0044800
282 Ga0395900_0100506
283 Ga0395898_0008715
284 Ga0395898_0020023
285 Ga0395898_0050440
286 Ga0395898_0051078
287 Ga0395898_0511977
288 Ga0395898_0815755
289 Ga0395905_0012487
290 Ga0395905_0020599
291 Ga0395905_0284289
292 Ga0395905_0480751
293 Ga0395905_0630401
294 Ga0395901_0007318
295 Ga0395901_0016696
296 Ga0395901_0101102
297 Ga0395901_0206353
298 Ga0395901_0366233
299 Ga0395901_0704053
300 Ga0395901_0967114
301 Ga0439436_0022551
302 Ga0439447_032761
303 Ga0439453_0054488
304 Ga0439461_0001313
305 Ga0439461_0016878
306 Ga0439466_0112624
307 Ga0439465_0253944
308 Ga0439465_0350446
309 Ga0439465_0390403
310 Ga0451841_0983949
311 Ga0451853_1264267
312 Ga0439442_013079
313 Ga0439442_013356
314 Ga0439445_0017161
315 Ga0439445_0027210
316 Ga0439445_0036481
317 Ga0439432_052922
318 Ga0439462_0007425
319 Ga0450914_040911
320 Ga0450920_061387
321 Ga0450910_081016
322 Ga0450910_098256
323 Ga0439446_0001153
324 Ga0439446_0005059
325 Ga0450909_031212
326 Ga0439434_0010805
327 Ga0439434_0024402
328 Ga0439434_0057228
329 Ga0439459_0178027
330 Ga0439460_0354264
331 Ga0450918_028040
332 Ga0466963_1192916
333 Ga0466960_0263595
334 Ga0451576_1726508
335 Ga0466967_0892663
336 Ga0495641_0467836
337 Ga0495605_0297682
338 Ga0495584_0649073
339 Ga0495607_0199950
340 Ga0495620_0193936
341 Ga0495628_0476524
342 Ga0495644_0050600
343 Ga0495640_0293063
344 Ga0495609_0320258
345 Ga0495633_0274186
346 Ga0495667_0089601
347 Ga0495656_0066742
348 Ga0495656_0106216
349 Ga0495656_0126079
350 Ga0495634_0117570
351 Ga0495635_0002676
352 Ga0495661_0290074
353 Ga0495670_0062342
354 Ga0495670_0212152
355 Ga0495589_0302087
356 Ga0495600_0700664
357 Ga0495636_0677392
358 Ga0495674_0052650
359 Ga0495674_0858131
360 Ga0495680_0053436
361 Ga0495677_0269128
362 Ga0495684_0727643
363 Ga0496104_0283762
364 Ga0496105_0380083
365 Ga0496105_1163332
366 Ga0496108_1578787
367 Ga0496110_0523344
368 Ga0496111_0158535
369 Ga0496111_1104357
370 Ga0496112_1139268
371 Ga0501031_0748434
372 Ga0501036_1726394
373 Ga0501038_0745927
374 Ga0501038_1319818
375 Ga0501040_0347801
376 Ga0501040_0373167
377 Ga0501041_0216284
378 Ga0501042_0088134
379 Ga0501042_0196223
380 Ga0501042_0527227
381 Ga0501046_0755383
382 Ga0501048_1342219
383 Ga0501070_0781043
384 Ga0501071_0175862
385 Ga0501071_0539224
386 Ga0501071_1100604
387 Ga0501072_0077366
388 Ga0501072_1180348
389 Ga0501073_0882798
390 Ga0501074_0498178
391 Ga0501074_0884747
392 Ga0501075_0069663
393 Ga0501075_0520054
394 Ga0501076_0238043
395 Ga0501076_0595375
396 Ga0501076_0662377
397 Ga0501077_0281736
398 Ga0501077_0597347
399 Ga0501080_1355088
400 Ga0501081_0464128
401 Ga0501044_1101774
402 Ga0501045_0217113
403 Ga0501045_0293916
404 nmdc:mga05p37_1020462_c1
405 nmdc:mga05p37_381906_c1
406 nmdc:mga08y16_18173_c1
407 nmdc:mga0a205_251581_c1
408 Ga0495595_0042676
409 Ga0495619_0490637
410 Ga0501084_0089746
411 Ga0501084_0319052
412 Ga0590075_061507
413 Ga0501082_0372068
414 Ga0501082_1456816
415 Ga0530510_0722160
416 Ga0530510_0903537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ccr-assembly1.cif.gz_A crystal structure of the t19d mutant of the de novo diheme binding 4d2 0.6804 3 117
7tai-assembly1.cif.gz_A structure of steap2 in complex with ligands 0.6463 4 116
8dz8-assembly2.cif.gz_B neoleukin 4, a de novo designed il-4 mimetic 0.6439 3 114
8dz8-assembly7.cif.gz_G neoleukin 4, a de novo designed il-4 mimetic 0.6293 3 110
8dz8-assembly2.cif.gz_B neoleukin 4, a de novo designed il-4 mimetic 0.6288 3 114
ID Description Score Start End Superfamily
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6441 5 117 1.20.120.1770
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6422 5 117 1.20.120.1770
af_G5E8H5_204_333_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6272 5 118 1.20.120.350
af_I1M6P3_209_389_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6245 3 117 1.20.120.1770
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6199 5 117 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A7W0YSV2-F1-model_v4 DUF2306 domain-containing protein 0.9513 2 116 GO:0016020
AF-A0A7V9FXS4-F1-model_v4 Cytochrome b561 domain-containing protein 0.9489 3 118 GO:0016020
AF-A0A538GX00-F1-model_v4 Cytochrome b561 domain-containing protein 0.9415 1 118 GO:0016020
AF-A0A7W0SVZ1-F1-model_v4 DUF2306 domain-containing protein 0.9404 1 116 GO:0016020
AF-A0A7V9FXS4-F1-model_v4 Cytochrome b561 domain-containing protein 0.926 3 118 GO:0016020

Map