F317540

General Info

Members Datasets Scaffolds Average Seq Length
208 144 416 199

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100765824|Ga0070665_1007658241
Length 224
Sequence MSSALKTIPAGYGKALRLATGQTVRLVNTYGTQVVDCWAWNAADLAEHMSMEASRVWSQRLNPIVGDSFVTTRRRPILTIVEDTSPGVHDSFMAACDCHRYRLLGVRTYHRNCLDNMHEALAEMGLKAPVSIASFNIFMNIAVQPDGRNLLTGPTPCRPGDSICLRAEMDCIVAFSACPQDIVPIQGGTANIPRDAHFEILDDGFVEIPLSPTWVPDRAASVRR

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
143 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
144 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 0.96
Rhizosphere 85.58
Stem 0
Stem Tuber 0.48
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100765824 3300005548 Bacteria 978
2 JGI25405J52794_10000026 3300003911 Bacteria 15640
3 Ga0070666_10573848 3300005335 Bacteria 822
4 Ga0070680_100020662 3300005336 Bacteria 5227
5 Ga0070680_100948378 3300005336 Bacteria 743
6 Ga0070669_100241822 3300005353 Bacteria 1434
7 Ga0070671_100112416 3300005355 Bacteria 2288
8 Ga0070709_10036042 3300005434 Bacteria 3010
9 Ga0070709_10094278 3300005434 Bacteria 1980
10 Ga0070709_10245827 3300005434 Bacteria 1287
11 Ga0070714_100022480 3300005435 Bacteria 5171
12 Ga0070714_100045212 3300005435 Bacteria 3731
13 Ga0070714_100131383 3300005435 Unclassified 2238
14 Ga0070714_100406177 3300005435 Bacteria 1288
15 Ga0070713_100077402 3300005436 Bacteria 2828
16 Ga0070713_100128369 3300005436 Bacteria 2233
17 Ga0070713_100559271 3300005436 Bacteria 1084
18 Ga0070713_100582078 3300005436 Bacteria 1062
19 Ga0070710_10039162 3300005437 Bacteria 2607
20 Ga0070710_10061435 3300005437 Bacteria 2140
21 Ga0070711_100263302 3300005439 Unclassified 1357
22 Ga0070681_10016908 3300005458 Bacteria 7287
23 Ga0070707_100003211 3300005468 Bacteria 15463
24 Ga0070707_100571084 3300005468 Bacteria 1093
25 Ga0070698_100116366 3300005471 Bacteria 2637
26 Ga0070699_100572822 3300005518 Unclassified 1028
27 Ga0070679_100003976 3300005530 Bacteria 13614
28 Ga0070684_100306388 3300005535 Bacteria 1458
29 Ga0068853_100849172 3300005539 Bacteria 876
30 Ga0070665_100216362 3300005548 Bacteria 1917
31 Ga0068856_100171476 3300005614 Bacteria 2182
32 Ga0068856_100267356 3300005614 Bacteria 1726
33 Ga0068864_100573939 3300005618 Bacteria 1092
34 Ga0068858_101003980 3300005842 Bacteria 818
35 Ga0081538_10004465 3300005981 Bacteria 12892
36 Ga0081540_1009599 3300005983 Bacteria 6655
37 Ga0081540_1017293 3300005983 Unclassified 4468
38 Ga0070717_10158913 3300006028 Bacteria 1960
39 Ga0070717_10887629 3300006028 Unclassified 811
40 Ga0075365_10027695 3300006038 Bacteria 3608
41 Ga0075363_100060495 3300006048 Bacteria 2039
42 Ga0070715_10128237 3300006163 Bacteria 1218
43 Ga0070712_100042470 3300006175 Bacteria 3126
44 Ga0070712_100096709 3300006175 Bacteria 2174
45 Ga0070712_100554682 3300006175 Unclassified 968
46 Ga0075362_10040335 3300006177 Bacteria 2055
47 Ga0075366_10156825 3300006195 Bacteria 1379
48 Ga0075370_10127910 3300006353 Bacteria 1481
49 Ga0075434_100636729 3300006871 Bacteria 1085
50 Ga0105245_10131062 3300009098 Bacteria 2352
51 Ga0105243_10346064 3300009148 Bacteria 1363
52 Ga0105238_10084006 3300009551 Bacteria 3173
53 Ga0099796_10006286 3300010159 Bacteria 3029
54 Ga0099796_10022926 3300010159 Bacteria 1943
55 Ga0105239_10047368 3300010375 Bacteria 4711
56 Ga0157370_10037070 3300013104 Bacteria 4728
57 Ga0157369_10499214 3300013105 Bacteria 1259
58 Ga0163162_10179360 3300013306 Bacteria 2244
59 Ga0163162_10758485 3300013306 Bacteria 1089
60 Ga0157375_10945082 3300013308 Bacteria 1004
61 Ga0157379_10377339 3300014968 Bacteria 1301
62 Ga0157376_11563596 3300014969 Bacteria 693
63 Ga0213874_10026967 3300021377 Bacteria 1631
64 Ga0213875_10007614 3300021388 Bacteria 5583
65 Ga0213875_10069784 3300021388 Bacteria 1640
66 Ga0228598_1006946 3300024227 Bacteria 2324
67 Ga0209233_1000047 3300025261 Bacteria 459614
68 Ga0209233_1035619 3300025261 Bacteria 1123
69 Ga0207692_10013830 3300025898 Bacteria 3511
70 Ga0207692_10316478 3300025898 Bacteria 954
71 Ga0207680_10243106 3300025903 Bacteria 1241
72 Ga0207684_10172721 3300025910 Bacteria 1863
73 Ga0207707_10354716 3300025912 Bacteria 1263
74 Ga0207693_10009126 3300025915 Bacteria 8096
75 Ga0207693_10021924 3300025915 Bacteria 5079
76 Ga0207693_10049407 3300025915 Bacteria 3303
77 Ga0207663_10058329 3300025916 Bacteria 2436
78 Ga0207660_10481182 3300025917 Bacteria 1006
79 Ga0207652_10028625 3300025921 Bacteria 4651
80 Ga0207646_10103033 3300025922 Bacteria 2559
81 Ga0207681_10341101 3300025923 Bacteria 1197
82 Ga0207659_10371457 3300025926 Bacteria 1191
83 Ga0207687_10055349 3300025927 Bacteria 2779
84 Ga0207700_10030045 3300025928 Bacteria 3843
85 Ga0207700_10286190 3300025928 Bacteria 1419
86 Ga0207700_10345364 3300025928 Bacteria 1295
87 Ga0207700_10484962 3300025928 Bacteria 1093
88 Ga0207700_10777206 3300025928 Bacteria 856
89 Ga0207664_10051053 3300025929 Bacteria 3264
90 Ga0207664_10110928 3300025929 Bacteria 2282
91 Ga0207644_10572726 3300025931 Bacteria 936
92 Ga0207670_10265069 3300025936 Bacteria 1333
93 Ga0207703_10430594 3300026035 Bacteria 1229
94 Ga0207639_10783683 3300026041 Bacteria 888
95 Ga0207702_10431779 3300026078 Bacteria 1275
96 Ga0268266_10693796 3300028379 Bacteria 981
97 Ga0307515_10063325 3300028794 Bacteria 5198
98 Ga0307406_11127519 3300031901 Bacteria 678
99 Ga0307414_10169479 3300032004 Unclassified 1744
100 Ga0316583_10004257 3300032133 Bacteria 5098
101 Ga0373926_0084569 3300035083 Bacteria 1176
102 Ga0373934_0077863 3300035086 Bacteria 1330
103 Ga0373944_0104954 3300035089 Bacteria 959
104 Ga0373923_0070244 3300035111 Bacteria 1503
105 Ga0373953_0025663 3300035117 Bacteria 2253
106 Ga0373954_0276575 3300035118 Bacteria 828
107 Ga0373956_0328928 3300035119 Bacteria 728
108 Ga0373943_0128905 3300035170 Bacteria 1352
109 Ga0373946_0025904 3300035171 Bacteria 2309
110 Ga0373924_0017674 3300035410 Bacteria 2739
111 Ga0373924_0039279 3300035410 Bacteria 1933
112 Ga0373924_0057210 3300035410 Bacteria 1626
113 Ga0373935_0021267 3300035692 Bacteria 3971
114 Ga0373935_0096295 3300035692 Bacteria 1945
115 Ga0373935_0840313 3300035692 Bacteria 679
116 Ga0373927_0096888 3300035695 Bacteria 1917
117 Ga0373927_0381013 3300035695 Bacteria 930
118 Ga0373927_0387138 3300035695 Bacteria 922
119 Ga0373927_0437252 3300035695 Bacteria 864
120 Ga0373933_0001103 3300035724 Bacteria 16093
121 Ga0373947_0041781 3300035725 Bacteria 2736
122 Ga0373947_0101597 3300035725 Bacteria 1808
123 Ga0373947_0144328 3300035725 Bacteria 1529
124 Ga0373947_0179329 3300035725 Unclassified 1378
125 Ga0373947_0240588 3300035725 Bacteria 1194
126 Ga0373947_0616275 3300035725 Bacteria 740
127 Ga0373937_0001034 3300036401 Bacteria 23525
128 Ga0373937_0085279 3300036401 Bacteria 2923
129 Ga0373937_0677798 3300036401 Bacteria 977
130 Ga0373925_0027552 3300037068 Bacteria 4158
131 Ga0373925_0039064 3300037068 Bacteria 3511
132 Ga0436364_0017997 3300037853 Bacteria 22070
133 Ga0436364_1093291 3300037853 Bacteria 66156
134 Ga0436364_1119683 3300037853 Bacteria 5953
135 Ga0436364_1420789 3300037853 Bacteria 6232
136 Ga0436365_0319401 3300039437 Bacteria 2302
137 Ga0436365_0431975 3300039437 Bacteria 1845
138 Ga0436365_1253418 3300039437 Bacteria 1567
139 Ga0436360_0043709 3300039438 Bacteria 1432
140 Ga0436360_0867917 3300039438 Bacteria 2552
141 Ga0436360_1079761 3300039438 Bacteria 2356
142 Ga0436360_1085984 3300039438 Bacteria 872
143 Ga0436361_0915593 3300039447 Bacteria 2450
144 Ga0436361_1130862 3300039447 Bacteria 2242
145 Ga0436363_1105469 3300039450 Bacteria 1535
146 Ga0436362_0025329 3300039453 Bacteria 1040
147 Ga0436362_0394653 3300039453 Bacteria 1384
148 Ga0436362_0537980 3300039453 Bacteria 1554
149 Ga0453683_0303680 3300044673 Unclassified 1021
150 Ga0466967_0087914 3300045976 Bacteria 2819
151 Ga0495592_0131630 3300046454 Bacteria 1749
152 Ga0495629_0134588 3300046459 Bacteria 1721
153 Ga0495651_0255210 3300046462 Unclassified 1195
154 Ga0495580_0023280 3300046472 Bacteria 4551
155 Ga0495662_0218667 3300046476 Bacteria 939
156 Ga0495608_0056221 3300046511 Bacteria 2599
157 Ga0495618_0115991 3300046514 Bacteria 1715
158 Ga0495666_0169619 3300046526 Bacteria 1010
159 Ga0495640_0089513 3300046533 Bacteria 2033
160 Ga0495640_0342655 3300046533 Bacteria 923
161 Ga0495586_0139045 3300046535 Unclassified 1362
162 Ga0495587_0185835 3300046536 Bacteria 1177
163 Ga0495587_0197806 3300046536 Unclassified 1137
164 Ga0495645_0270490 3300046543 Bacteria 1122
165 Ga0495667_0000668 3300046559 Bacteria 21925
166 Ga0495667_0022264 3300046559 Bacteria 4271
167 Ga0495667_0225541 3300046559 Bacteria 1195
168 Ga0495634_0035862 3300046642 Bacteria 3394
169 Ga0495625_0161897 3300046660 Bacteria 1499
170 Ga0495635_0059136 3300046663 Bacteria 2636
171 Ga0495635_0181015 3300046663 Bacteria 1432
172 Ga0495635_0353419 3300046663 Bacteria 980
173 Ga0495657_0276997 3300046675 Bacteria 1005
174 Ga0495657_0371516 3300046675 Bacteria 844
175 Ga0495599_0023120 3300046678 Bacteria 3885
176 Ga0495646_0046884 3300046680 Bacteria 2633
177 Ga0495647_0018216 3300046681 Bacteria 2497
178 Ga0495613_0249966 3300046689 Bacteria 1238
179 Ga0495600_0239957 3300046809 Bacteria 1155
180 Ga0495680_0033523 3300047322 Bacteria 4156
181 Ga0495675_0106684 3300047444 Unclassified 1750
182 Ga0495684_0053770 3300047471 Bacteria 3072
183 Ga0495684_0260205 3300047471 Bacteria 1259
184 Ga0495686_0008235 3300047472 Bacteria 7686
185 Ga0495602_0077468 3300048088 Bacteria 2813
186 Ga0496104_0428352 3300048907 Bacteria 1235
187 Ga0496108_0814961 3300048911 Bacteria 805
188 Ga0496118_0192505 3300048921 Bacteria 1218
189 Ga0501031_0812007 3300049568 Bacteria 599
190 Ga0501034_0411360 3300049571 Bacteria 1275
191 Ga0501043_0146776 3300049579 Bacteria 1847
192 Ga0501070_0257255 3300049586 Bacteria 1427
193 Ga0501080_0342886 3300049742 Bacteria 1350
194 Ga0501035_0091121 3300049822 Bacteria 2683
195 Ga0501035_0317030 3300049822 Bacteria 1311
196 Ga0501044_0084192 3300049823 Bacteria 3215
197 nmdc:mga03683_37362_c1 3300050489 Bacteria 1979
198 nmdc:mga0k408_182970_c2 3300050493 Bacteria 897
199 nmdc:mga07m45_158980_c1 3300050496 Bacteria 1311
200 nmdc:mga08y16_1132655_c1 3300050511 Bacteria 756
201 Ga0495601_0004868 3300053077 Bacteria 7792
202 Ga0495595_0001371 3300053084 Bacteria 9460
203 Ga0495619_0007079 3300053085 Bacteria 7098
204 Ga0500607_158921 3300053121 Bacteria 1036
205 Ga0500622_0007449 3300053156 Bacteria 6217
206 2643758713 2643221547 Bacteria 4740017
207 2855021892 2855020534 Bacteria 3204685
208 8045867119 8045864390 Bacteria 5043873
209 Ga0070665_100765824
210 JGI25405J52794_10000026
211 Ga0070666_10573848
212 Ga0070680_100020662
213 Ga0070680_100948378
214 Ga0070669_100241822
215 Ga0070671_100112416
216 Ga0070709_10036042
217 Ga0070709_10094278
218 Ga0070709_10245827
219 Ga0070714_100022480
220 Ga0070714_100045212
221 Ga0070714_100131383
222 Ga0070714_100406177
223 Ga0070713_100077402
224 Ga0070713_100128369
225 Ga0070713_100559271
226 Ga0070713_100582078
227 Ga0070710_10039162
228 Ga0070710_10061435
229 Ga0070711_100263302
230 Ga0070681_10016908
231 Ga0070707_100003211
232 Ga0070707_100571084
233 Ga0070698_100116366
234 Ga0070699_100572822
235 Ga0070679_100003976
236 Ga0070684_100306388
237 Ga0068853_100849172
238 Ga0070665_100216362
239 Ga0068856_100171476
240 Ga0068856_100267356
241 Ga0068864_100573939
242 Ga0068858_101003980
243 Ga0081538_10004465
244 Ga0081540_1009599
245 Ga0081540_1017293
246 Ga0070717_10158913
247 Ga0070717_10887629
248 Ga0075365_10027695
249 Ga0075363_100060495
250 Ga0070715_10128237
251 Ga0070712_100042470
252 Ga0070712_100096709
253 Ga0070712_100554682
254 Ga0075362_10040335
255 Ga0075366_10156825
256 Ga0075370_10127910
257 Ga0075434_100636729
258 Ga0105245_10131062
259 Ga0105243_10346064
260 Ga0105238_10084006
261 Ga0099796_10006286
262 Ga0099796_10022926
263 Ga0105239_10047368
264 Ga0157370_10037070
265 Ga0157369_10499214
266 Ga0163162_10179360
267 Ga0163162_10758485
268 Ga0157375_10945082
269 Ga0157379_10377339
270 Ga0157376_11563596
271 Ga0213874_10026967
272 Ga0213875_10007614
273 Ga0213875_10069784
274 Ga0228598_1006946
275 Ga0209233_1000047
276 Ga0209233_1035619
277 Ga0207692_10013830
278 Ga0207692_10316478
279 Ga0207680_10243106
280 Ga0207684_10172721
281 Ga0207707_10354716
282 Ga0207693_10009126
283 Ga0207693_10021924
284 Ga0207693_10049407
285 Ga0207663_10058329
286 Ga0207660_10481182
287 Ga0207652_10028625
288 Ga0207646_10103033
289 Ga0207681_10341101
290 Ga0207659_10371457
291 Ga0207687_10055349
292 Ga0207700_10030045
293 Ga0207700_10286190
294 Ga0207700_10345364
295 Ga0207700_10484962
296 Ga0207700_10777206
297 Ga0207664_10051053
298 Ga0207664_10110928
299 Ga0207644_10572726
300 Ga0207670_10265069
301 Ga0207703_10430594
302 Ga0207639_10783683
303 Ga0207702_10431779
304 Ga0268266_10693796
305 Ga0307515_10063325
306 Ga0307406_11127519
307 Ga0307414_10169479
308 Ga0316583_10004257
309 Ga0373926_0084569
310 Ga0373934_0077863
311 Ga0373944_0104954
312 Ga0373923_0070244
313 Ga0373953_0025663
314 Ga0373954_0276575
315 Ga0373956_0328928
316 Ga0373943_0128905
317 Ga0373946_0025904
318 Ga0373924_0017674
319 Ga0373924_0039279
320 Ga0373924_0057210
321 Ga0373935_0021267
322 Ga0373935_0096295
323 Ga0373935_0840313
324 Ga0373927_0096888
325 Ga0373927_0381013
326 Ga0373927_0387138
327 Ga0373927_0437252
328 Ga0373933_0001103
329 Ga0373947_0041781
330 Ga0373947_0101597
331 Ga0373947_0144328
332 Ga0373947_0179329
333 Ga0373947_0240588
334 Ga0373947_0616275
335 Ga0373937_0001034
336 Ga0373937_0085279
337 Ga0373937_0677798
338 Ga0373925_0027552
339 Ga0373925_0039064
340 Ga0436364_0017997
341 Ga0436364_1093291
342 Ga0436364_1119683
343 Ga0436364_1420789
344 Ga0436365_0319401
345 Ga0436365_0431975
346 Ga0436365_1253418
347 Ga0436360_0043709
348 Ga0436360_0867917
349 Ga0436360_1079761
350 Ga0436360_1085984
351 Ga0436361_0915593
352 Ga0436361_1130862
353 Ga0436363_1105469
354 Ga0436362_0025329
355 Ga0436362_0394653
356 Ga0436362_0537980
357 Ga0453683_0303680
358 Ga0466967_0087914
359 Ga0495592_0131630
360 Ga0495629_0134588
361 Ga0495651_0255210
362 Ga0495580_0023280
363 Ga0495662_0218667
364 Ga0495608_0056221
365 Ga0495618_0115991
366 Ga0495666_0169619
367 Ga0495640_0089513
368 Ga0495640_0342655
369 Ga0495586_0139045
370 Ga0495587_0185835
371 Ga0495587_0197806
372 Ga0495645_0270490
373 Ga0495667_0000668
374 Ga0495667_0022264
375 Ga0495667_0225541
376 Ga0495634_0035862
377 Ga0495625_0161897
378 Ga0495635_0059136
379 Ga0495635_0181015
380 Ga0495635_0353419
381 Ga0495657_0276997
382 Ga0495657_0371516
383 Ga0495599_0023120
384 Ga0495646_0046884
385 Ga0495647_0018216
386 Ga0495613_0249966
387 Ga0495600_0239957
388 Ga0495680_0033523
389 Ga0495675_0106684
390 Ga0495684_0053770
391 Ga0495684_0260205
392 Ga0495686_0008235
393 Ga0495602_0077468
394 Ga0496104_0428352
395 Ga0496108_0814961
396 Ga0496118_0192505
397 Ga0501031_0812007
398 Ga0501034_0411360
399 Ga0501043_0146776
400 Ga0501070_0257255
401 Ga0501080_0342886
402 Ga0501035_0091121
403 Ga0501035_0317030
404 Ga0501044_0084192
405 nmdc:mga03683_37362_c1
406 nmdc:mga0k408_182970_c2
407 nmdc:mga07m45_158980_c1
408 nmdc:mga08y16_1132655_c1
409 Ga0495601_0004868
410 Ga0495595_0001371
411 Ga0495619_0007079
412 Ga0500607_158921
413 Ga0500622_0007449
414 2643758713
415 2855021892
416 8045867119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09347

DUF1989

Domain of unknown function (DUF1989)

6

172

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.9576 3 197
3oru-assembly1.cif.gz_A crystal structure of a duf1989 family protein (tm1040_0329) from silicibacter sp. tm1040 at 1.11 a resolution 0.9388 3 197
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.8627 3 197
3di4-assembly1.cif.gz_B crystal structure of a duf1989 family protein (spo0365) from silicibacter pomeroyi dss-3 at 1.60 a resolution 0.8463 3 197
4i0w-assembly2.cif.gz_D structure of the clostridium perfringens cspb protease 0.5169 2 197
ID Description Score Start End Superfamily
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.6773 10 174 2.60.120.1030
af_Q7K284_1_83_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.644 10 174 2.60.120.1030
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6102 1 197 2.60.120.10
af_A4ID25_1_85_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.5732 11 176 2.60.120.1030
af_E7F3I6_19_100_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.563 10 174 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A0H5LT90-F1-model_v4 Urea carboxylase-associated protein 1 0.9813 3 198
AF-A0A2E5PCG5-F1-model_v4 Aminomethyltransferase 0.9811 3 198 GO:0008168
GO:0032259
AF-A0A3N9UL98-F1-model_v4 Urea carboxylase-associated family protein 0.9808 3 197
AF-A0A0T9LJL1-F1-model_v4 Urea carboxylase-associated protein 1 0.9806 3 198
AF-A0A6H0IUB2-F1-model_v4 Urea carboxylase-associated family protein 0.9806 3 197

Map