F317468

General Info

Members Datasets Scaffolds Average Seq Length
208 163 416 340

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100025601|Ga0070700_1000256013
Length 364
Sequence VADESPAERGHHHLTPEQDGTWQAADVLPSTIPTTDYHTGGEPFRIVANPPVPIAGRTVAERRARAIEDPMVQSLRAVLCSEPRGHADMYGGFIVPPDDDGADLGVLFWHKDGFSTACGHGTIALGAWAVETGRVAAPRTGSVDVVIDVPSGRVTARVHREAARVTAVDFVNVPSWVVARNVPVCISRGEVRVTVAYGGAIYATLPAGQLGLSVTPERLGDLIALGREIKWALNDTEQAVHPTDPRLNGIYGTIWFDDLGDLAGQVHQRNVTVFADGEVDRSPCGSGTCARLAVLAAEGRLPTGTVLRHESIVGSTFDGIVLDTVDIEGRPAVIPQVTGTAYKTGEHVFWIDPNDPLVPGFVLR

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
152 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
153 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
154 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
155 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
156 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
157 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
158 2867475112 Streptomyces sp. TM32 Isolate Unclassified
159 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
160 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
161 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
162 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
163 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 7.69
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100025601 3300005441 Bacteria 3475
2 Ga0070660_100065431 3300005339 Bacteria 2829
3 Ga0070671_100118776 3300005355 Bacteria 2224
4 Ga0070667_100149046 3300005367 Bacteria 2054
5 Ga0070714_100137661 3300005435 Bacteria 2188
6 Ga0070713_100087113 3300005436 Bacteria 2678
7 Ga0070713_100109626 3300005436 Bacteria 2405
8 Ga0070710_10056582 3300005437 Bacteria 2219
9 Ga0070711_100010273 3300005439 Bacteria 5791
10 Ga0070662_100126239 3300005457 Bacteria 1967
11 Ga0068853_100129548 3300005539 Bacteria 2257
12 Ga0070672_100209749 3300005543 Bacteria 1631
13 Ga0070695_100067574 3300005545 Bacteria 2331
14 Ga0068855_100103646 3300005563 Bacteria 3273
15 Ga0070664_100273697 3300005564 Bacteria 1521
16 Ga0068856_100062264 3300005614 Bacteria 3685
17 Ga0068856_100116574 3300005614 Bacteria 2671
18 Ga0068852_100182169 3300005616 Bacteria 1976
19 Ga0068864_100186134 3300005618 Bacteria 1901
20 Ga0068866_10132949 3300005718 Bacteria 1418
21 Ga0068861_100065415 3300005719 Bacteria 2801
22 Ga0068858_100023684 3300005842 Bacteria 5720
23 Ga0081455_10016581 3300005937 Bacteria 7104
24 Ga0070717_10194780 3300006028 Bacteria 1772
25 Ga0070717_10258379 3300006028 Bacteria 1540
26 Ga0070716_100004549 3300006173 Bacteria 6648
27 Ga0070712_100007415 3300006175 Bacteria 6846
28 Ga0075370_10118933 3300006353 Bacteria 1537
29 Ga0068871_100079857 3300006358 Bacteria 2707
30 Ga0075428_100010852 3300006844 Bacteria 10127
31 Ga0075430_100009629 3300006846 Bacteria 8165
32 Ga0075431_100040629 3300006847 Bacteria 4794
33 Ga0075429_100013158 3300006880 Bacteria 7177
34 Ga0075429_100068790 3300006880 Bacteria 3082
35 Ga0105240_10245667 3300009093 Bacteria 2073
36 Ga0105247_10144956 3300009101 Bacteria 1560
37 Ga0114129_10005004 3300009147 Bacteria 18663
38 Ga0105237_10100058 3300009545 Bacteria 2890
39 Ga0105239_10172372 3300010375 Bacteria 2420
40 Ga0105239_10325119 3300010375 Bacteria 1735
41 Ga0157374_10190811 3300013296 Bacteria 2004
42 Ga0157372_10000091 3300013307 Bacteria 93310
43 Ga0163163_10012499 3300014325 Bacteria 7738
44 Ga0163163_10106548 3300014325 Bacteria 2829
45 Ga0157377_10018968 3300014745 Bacteria 3586
46 Ga0157376_10032095 3300014969 Bacteria 4213
47 Ga0207653_10070189 3300025885 Bacteria 1196
48 Ga0207692_10036596 3300025898 Bacteria 2395
49 Ga0207692_10061110 3300025898 Bacteria 1951
50 Ga0207699_10008248 3300025906 Bacteria 5131
51 Ga0207699_10039750 3300025906 Bacteria 2705
52 Ga0207643_10151021 3300025908 Bacteria 1393
53 Ga0207693_10005745 3300025915 Bacteria 10296
54 Ga0207693_10065774 3300025915 Bacteria 2838
55 Ga0207693_10237549 3300025915 Bacteria 1431
56 Ga0207663_10016763 3300025916 Bacteria 4071
57 Ga0207663_10054057 3300025916 Bacteria 2512
58 Ga0207663_10117453 3300025916 Bacteria 1815
59 Ga0207657_10013205 3300025919 Bacteria 8108
60 Ga0207687_10192611 3300025927 Bacteria 1588
61 Ga0207700_10046103 3300025928 Bacteria 3222
62 Ga0207700_10223147 3300025928 Bacteria 1599
63 Ga0207700_10225967 3300025928 Bacteria 1589
64 Ga0207664_10003358 3300025929 Bacteria 10642
65 Ga0207664_10038637 3300025929 Bacteria 3703
66 Ga0207664_10056550 3300025929 Bacteria 3116
67 Ga0207665_10007707 3300025939 Bacteria 7107
68 Ga0207711_10233223 3300025941 Bacteria 1686
69 Ga0207661_10057281 3300025944 Bacteria 3133
70 Ga0207661_10380881 3300025944 Bacteria 1277
71 Ga0207640_10037222 3300025981 Bacteria 3060
72 Ga0207703_10029985 3300026035 Bacteria 4295
73 Ga0207678_10020293 3300026067 Bacteria 5831
74 Ga0207708_10092894 3300026075 Bacteria 2329
75 Ga0207702_10094531 3300026078 Bacteria 2624
76 Ga0207641_10175244 3300026088 Bacteria 1961
77 Ga0207675_100189155 3300026118 Bacteria 1974
78 Ga0207683_10005604 3300026121 Bacteria 10767
79 Ga0207698_10553761 3300026142 Bacteria 1128
80 Ga0268266_10126253 3300028379 Bacteria 2284
81 Ga0307413_10115306 3300031824 Bacteria 1808
82 Ga0307518_10000028 3300031838 Bacteria 98010
83 Ga0307407_10143235 3300031903 Bacteria 1545
84 Ga0307409_100034786 3300031995 Bacteria 3685
85 Ga0307414_10049438 3300032004 Bacteria 2908
86 Ga0307415_100320785 3300032126 Bacteria 1292
87 Ga0373926_0032941 3300035083 Bacteria 1830
88 Ga0373944_0030837 3300035089 Bacteria 1610
89 Ga0373923_0024948 3300035111 Bacteria 2365
90 Ga0373932_0005228 3300035112 Bacteria 3051
91 Ga0373945_0002254 3300035116 Bacteria 6028
92 Ga0373943_0000270 3300035170 Bacteria 21406
93 Ga0373946_0000423 3300035171 Bacteria 13798
94 Ga0373962_0058788 3300035242 Bacteria 1125
95 Ga0373935_0097079 3300035692 Bacteria 1938
96 Ga0373935_0134138 3300035692 Bacteria 1666
97 Ga0373935_0159083 3300035692 Bacteria 1538
98 Ga0373927_0001743 3300035695 Bacteria 16246
99 Ga0373927_0057973 3300035695 Bacteria 2504
100 Ga0373937_0028592 3300036401 Bacteria 5046
101 Ga0395900_0290397 3300037418 Bacteria 1624
102 Ga0436364_0467712 3300037853 Bacteria 1222
103 Ga0395901_0048334 3300038443 Bacteria 4418
104 Ga0395901_0096315 3300038443 Bacteria 3101
105 Ga0400483_020866 3300039062 Bacteria 6567
106 Ga0400483_245994 3300039062 Bacteria 5534
107 Ga0466966_0046516 3300044684 Bacteria 2770
108 Ga0466966_0068165 3300044684 Bacteria 2234
109 Ga0466963_0000407 3300044694 Bacteria 19711
110 Ga0466963_0115211 3300044694 Bacteria 1847
111 Ga0466970_0021186 3300044765 Bacteria 3385
112 Ga0466960_0000651 3300044901 Bacteria 12050
113 Ga0466960_0079103 3300044901 Bacteria 1653
114 Ga0466959_0128158 3300045049 Bacteria 1800
115 Ga0466967_0001671 3300045976 Bacteria 13148
116 Ga0466967_0011811 3300045976 Bacteria 6642
117 Ga0466967_0040955 3300045976 Bacteria 3990
118 Ga0466967_0095610 3300045976 Bacteria 2708
119 Ga0466967_0160430 3300045976 Bacteria 2110
120 Ga0495592_0020557 3300046454 Bacteria 5023
121 Ga0495651_0003969 3300046462 Bacteria 11311
122 Ga0495653_0002649 3300046463 Bacteria 14243
123 Ga0495580_0045025 3300046472 Bacteria 3136
124 Ga0495639_0057779 3300046475 Bacteria 1773
125 Ga0495662_0015327 3300046476 Bacteria 3723
126 Ga0495664_0013608 3300046477 Bacteria 4614
127 Ga0495664_0142072 3300046477 Bacteria 1455
128 Ga0495608_0013452 3300046511 Bacteria 5675
129 Ga0495628_0003319 3300046516 Bacteria 14392
130 Ga0495628_0196144 3300046516 Bacteria 1523
131 Ga0495665_0004959 3300046531 Bacteria 7171
132 Ga0495586_0108659 3300046535 Bacteria 1543
133 Ga0495645_0005783 3300046543 Bacteria 8527
134 Ga0495645_0148414 3300046543 Bacteria 1631
135 Ga0495667_0002600 3300046559 Bacteria 12045
136 Ga0495667_0004312 3300046559 Bacteria 9594
137 Ga0495634_0141280 3300046642 Bacteria 1528
138 Ga0495657_0068722 3300046675 Bacteria 2320
139 Ga0495599_0001204 3300046678 Bacteria 14660
140 Ga0495599_0072120 3300046678 Bacteria 2155
141 Ga0495623_0109923 3300046679 Bacteria 1672
142 Ga0495624_0004109 3300046690 Bacteria 10709
143 Ga0495600_0002329 3300046809 Bacteria 10833
144 Ga0495600_0009206 3300046809 Bacteria 6093
145 Ga0495674_0040736 3300047319 Bacteria 4152
146 Ga0495676_0104527 3300047321 Bacteria 2089
147 Ga0495680_0006044 3300047322 Bacteria 11317
148 Ga0495680_0083391 3300047322 Bacteria 2410
149 Ga0495684_0001885 3300047471 Bacteria 16802
150 Ga0495684_0003816 3300047471 Bacteria 11744
151 Ga0495593_0053696 3300047673 Bacteria 2126
152 Ga0495602_0012883 3300048088 Bacteria 8569
153 Ga0495602_0115220 3300048088 Bacteria 2175
154 Ga0496100_0066184 3300048903 Bacteria 2396
155 Ga0496102_0056865 3300048905 Bacteria 3570
156 Ga0496102_0204474 3300048905 Bacteria 1861
157 Ga0496104_0036834 3300048907 Bacteria 4574
158 Ga0496104_0346385 3300048907 Bacteria 1398
159 Ga0496106_0274316 3300048909 Bacteria 1350
160 Ga0496108_0058036 3300048911 Bacteria 3252
161 Ga0496109_0066662 3300048912 Bacteria 3297
162 Ga0496109_0293229 3300048912 Bacteria 1533
163 Ga0496110_0009111 3300048913 Bacteria 8011
164 Ga0496110_0042145 3300048913 Bacteria 3984
165 Ga0496111_0060197 3300048914 Bacteria 2752
166 Ga0496112_0112951 3300048915 Bacteria 2687
167 Ga0496113_0043974 3300048916 Bacteria 3307
168 Ga0496113_0235492 3300048916 Bacteria 1460
169 Ga0496114_0334798 3300048917 Bacteria 1338
170 Ga0501031_0266642 3300049568 Bacteria 1112
171 Ga0501040_0010357 3300049576 Bacteria 6094
172 Ga0501043_0128807 3300049579 Bacteria 1984
173 Ga0501046_0157012 3300049580 Bacteria 1713
174 Ga0501067_0000233 3300049583 Bacteria 30809
175 Ga0501067_0029132 3300049583 Bacteria 3060
176 Ga0501068_0025765 3300049584 Bacteria 3461
177 Ga0501071_0001782 3300049587 Bacteria 12700
178 Ga0501072_0026579 3300049588 Bacteria 4513
179 Ga0501072_0103115 3300049588 Bacteria 2267
180 Ga0501074_0142571 3300049590 Bacteria 1713
181 Ga0501076_0168889 3300049592 Bacteria 1783
182 Ga0501080_0260806 3300049742 Bacteria 1579
183 Ga0501045_0005685 3300049824 Bacteria 8628
184 nmdc:mga05p37_3297_c1 3300050507 Bacteria 18828
185 nmdc:mga0qj67_23394_c1 3300050509 Bacteria 4753
186 nmdc:mga06r32_31545_c1 3300050510 Bacteria 4978
187 nmdc:mga08x19_69273_c1 3300050514 Bacteria 2297
188 Ga0495595_0001856 3300053084 Bacteria 8194
189 Ga0495619_0261040 3300053085 Bacteria 1200
190 Ga0500568_0000061 3300053139 Bacteria 107322
191 Ga0500577_0047566 3300053142 Bacteria 1595
192 Ga0500616_0002005 3300053153 Bacteria 18030
193 Ga0501084_0021639 3300054114 Bacteria 5362
194 Ga0501082_0287906 3300060353 Bacteria 1430
195 Ga0530510_0060411 3300061734 Bacteria 2743
196 2586061089 2585427649 Bacteria 9053857
197 2643942864 2643221587 Bacteria 7586415
198 2644019284 2643221601 Bacteria 7493239
199 2644174192 2643221631 Bacteria 8168043
200 2644430323 2643221677 Bacteria 7584031
201 2739323707 2738543027 Bacteria 6409078
202 2760303707 2758568522 Bacteria 5953541
203 2867477703 2867475112 Bacteria 6909112
204 2918501558 2918501144 Bacteria 8668083
205 2935391097 2935390628 Bacteria 7043367
206 2997607652 2997600082 Bacteria 9896405
207 3006489422 3006486233 Bacteria 8157040
208 8033688530 8033684223 Bacteria 6906479
209 Ga0070700_100025601
210 Ga0070660_100065431
211 Ga0070671_100118776
212 Ga0070667_100149046
213 Ga0070714_100137661
214 Ga0070713_100087113
215 Ga0070713_100109626
216 Ga0070710_10056582
217 Ga0070711_100010273
218 Ga0070662_100126239
219 Ga0068853_100129548
220 Ga0070672_100209749
221 Ga0070695_100067574
222 Ga0068855_100103646
223 Ga0070664_100273697
224 Ga0068856_100062264
225 Ga0068856_100116574
226 Ga0068852_100182169
227 Ga0068864_100186134
228 Ga0068866_10132949
229 Ga0068861_100065415
230 Ga0068858_100023684
231 Ga0081455_10016581
232 Ga0070717_10194780
233 Ga0070717_10258379
234 Ga0070716_100004549
235 Ga0070712_100007415
236 Ga0075370_10118933
237 Ga0068871_100079857
238 Ga0075428_100010852
239 Ga0075430_100009629
240 Ga0075431_100040629
241 Ga0075429_100013158
242 Ga0075429_100068790
243 Ga0105240_10245667
244 Ga0105247_10144956
245 Ga0114129_10005004
246 Ga0105237_10100058
247 Ga0105239_10172372
248 Ga0105239_10325119
249 Ga0157374_10190811
250 Ga0157372_10000091
251 Ga0163163_10012499
252 Ga0163163_10106548
253 Ga0157377_10018968
254 Ga0157376_10032095
255 Ga0207653_10070189
256 Ga0207692_10036596
257 Ga0207692_10061110
258 Ga0207699_10008248
259 Ga0207699_10039750
260 Ga0207643_10151021
261 Ga0207693_10005745
262 Ga0207693_10065774
263 Ga0207693_10237549
264 Ga0207663_10016763
265 Ga0207663_10054057
266 Ga0207663_10117453
267 Ga0207657_10013205
268 Ga0207687_10192611
269 Ga0207700_10046103
270 Ga0207700_10223147
271 Ga0207700_10225967
272 Ga0207664_10003358
273 Ga0207664_10038637
274 Ga0207664_10056550
275 Ga0207665_10007707
276 Ga0207711_10233223
277 Ga0207661_10057281
278 Ga0207661_10380881
279 Ga0207640_10037222
280 Ga0207703_10029985
281 Ga0207678_10020293
282 Ga0207708_10092894
283 Ga0207702_10094531
284 Ga0207641_10175244
285 Ga0207675_100189155
286 Ga0207683_10005604
287 Ga0207698_10553761
288 Ga0268266_10126253
289 Ga0307413_10115306
290 Ga0307518_10000028
291 Ga0307407_10143235
292 Ga0307409_100034786
293 Ga0307414_10049438
294 Ga0307415_100320785
295 Ga0373926_0032941
296 Ga0373944_0030837
297 Ga0373923_0024948
298 Ga0373932_0005228
299 Ga0373945_0002254
300 Ga0373943_0000270
301 Ga0373946_0000423
302 Ga0373962_0058788
303 Ga0373935_0097079
304 Ga0373935_0134138
305 Ga0373935_0159083
306 Ga0373927_0001743
307 Ga0373927_0057973
308 Ga0373937_0028592
309 Ga0395900_0290397
310 Ga0436364_0467712
311 Ga0395901_0048334
312 Ga0395901_0096315
313 Ga0400483_020866
314 Ga0400483_245994
315 Ga0466966_0046516
316 Ga0466966_0068165
317 Ga0466963_0000407
318 Ga0466963_0115211
319 Ga0466970_0021186
320 Ga0466960_0000651
321 Ga0466960_0079103
322 Ga0466959_0128158
323 Ga0466967_0001671
324 Ga0466967_0011811
325 Ga0466967_0040955
326 Ga0466967_0095610
327 Ga0466967_0160430
328 Ga0495592_0020557
329 Ga0495651_0003969
330 Ga0495653_0002649
331 Ga0495580_0045025
332 Ga0495639_0057779
333 Ga0495662_0015327
334 Ga0495664_0013608
335 Ga0495664_0142072
336 Ga0495608_0013452
337 Ga0495628_0003319
338 Ga0495628_0196144
339 Ga0495665_0004959
340 Ga0495586_0108659
341 Ga0495645_0005783
342 Ga0495645_0148414
343 Ga0495667_0002600
344 Ga0495667_0004312
345 Ga0495634_0141280
346 Ga0495657_0068722
347 Ga0495599_0001204
348 Ga0495599_0072120
349 Ga0495623_0109923
350 Ga0495624_0004109
351 Ga0495600_0002329
352 Ga0495600_0009206
353 Ga0495674_0040736
354 Ga0495676_0104527
355 Ga0495680_0006044
356 Ga0495680_0083391
357 Ga0495684_0001885
358 Ga0495684_0003816
359 Ga0495593_0053696
360 Ga0495602_0012883
361 Ga0495602_0115220
362 Ga0496100_0066184
363 Ga0496102_0056865
364 Ga0496102_0204474
365 Ga0496104_0036834
366 Ga0496104_0346385
367 Ga0496106_0274316
368 Ga0496108_0058036
369 Ga0496109_0066662
370 Ga0496109_0293229
371 Ga0496110_0009111
372 Ga0496110_0042145
373 Ga0496111_0060197
374 Ga0496112_0112951
375 Ga0496113_0043974
376 Ga0496113_0235492
377 Ga0496114_0334798
378 Ga0501031_0266642
379 Ga0501040_0010357
380 Ga0501043_0128807
381 Ga0501046_0157012
382 Ga0501067_0000233
383 Ga0501067_0029132
384 Ga0501068_0025765
385 Ga0501071_0001782
386 Ga0501072_0026579
387 Ga0501072_0103115
388 Ga0501074_0142571
389 Ga0501076_0168889
390 Ga0501080_0260806
391 Ga0501045_0005685
392 nmdc:mga05p37_3297_c1
393 nmdc:mga0qj67_23394_c1
394 nmdc:mga06r32_31545_c1
395 nmdc:mga08x19_69273_c1
396 Ga0495595_0001856
397 Ga0495619_0261040
398 Ga0500568_0000061
399 Ga0500577_0047566
400 Ga0500616_0002005
401 Ga0501084_0021639
402 Ga0501082_0287906
403 Ga0530510_0060411
404 2586061089
405 2643942864
406 2644019284
407 2644174192
408 2644430323
409 2739323707
410 2760303707
411 2867477703
412 2918501558
413 2935391097
414 2997607652
415 3006489422
416 8033688530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

34

362

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb0-assembly1.cif.gz_B crystal structure of a hydroxyproline epimerase from agrobacterium vitis, target efi-506420, with bound trans-4-oh-l-proline 0.9413 10 344
4k7g-assembly1.cif.gz_B crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site 0.9336 10 344
6r77-assembly1.cif.gz_B crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation 0.9333 10 345
4q2h-assembly1.cif.gz_B crystal structure of probable proline racemase from agrobacterium radiobacter k84, target efi-506561, with bound carbonate 0.9333 12 344
4lb0-assembly1.cif.gz_A crystal structure of a hydroxyproline epimerase from agrobacterium vitis, target efi-506420, with bound trans-4-oh-l-proline 0.9292 9 344
ID Description Score Start End Superfamily
4q2hB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9277 153 320 3.10.310.10
4q2hB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9223 153 320 3.10.310.10
4q2hB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9176 12 145 3.10.310.10
af_A0A0G2L1A2_13_139_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9132 12 137 3.10.310.10
af_Q868H8_7_132_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9032 14 137 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A6J7G2Y6-F1-model_v4 Unannotated protein 0.973 69 345 GO:0016836
AF-A0A6J7G2Y6-F1-model_v4 Unannotated protein 0.9696 69 345 GO:0016836
AF-A0A7V9KBR6-F1-model_v4 Proline racemase family protein 0.965 12 345 GO:0016836
AF-A0A7W7TY87-F1-model_v4 Proline racemase/trans-L-3-hydroxyproline dehydratase (EC 4.2.1.77, EC 5.1.1.4) 0.9628 11 344 GO:0018112
GO:0050346
AF-A0A0R2Q848-F1-model_v4 Proline racemase 0.9626 16 345 GO:0016836

Map