F317387

General Info

Members Datasets Scaffolds Average Seq Length
208 150 416 207

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100054955|Ga0068868_1000549553
Length 210
Sequence VAAGPSLGLYVAASLALIATPGQDMLYVITRSLAQGRLAGVCSALGVCCGILVHTALAALGIGALLLASEGLFAAVKLAGAAYLVYLGLRLLLSRVPPAALRAAAGRPLSAAGLVAQGMLSNVTNPKIVLFFLAFLPQFVEPHGLHPTRDLVFLGVLYAAMALPVKAAVGIAAGSLSERMLRSPAALAWMNRASGVVLVGLGLRLAASER

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
147 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
148 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
149 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
150 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 0
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 1.92
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100054955 3300005338 Bacteria 3140
2 rootH2_10109436 3300003320 Bacteria 3107
3 Ga0065712_10082987 3300005290 Bacteria 2862
4 Ga0070658_10048849 3300005327 Bacteria 3427
5 Ga0070683_100185912 3300005329 Bacteria 1972
6 Ga0068869_100048019 3300005334 Bacteria 3084
7 Ga0068869_100163119 3300005334 Bacteria 1736
8 Ga0068868_100171406 3300005338 Bacteria 1797
9 Ga0070689_100001716 3300005340 Bacteria 14008
10 Ga0070689_100096319 3300005340 Bacteria 2339
11 Ga0070661_100200887 3300005344 Bacteria 1523
12 Ga0070661_100432819 3300005344 Bacteria 1044
13 Ga0070675_100005306 3300005354 Bacteria 9845
14 Ga0070671_100458690 3300005355 Bacteria 1094
15 Ga0070674_100557386 3300005356 Bacteria 962
16 Ga0070674_100793857 3300005356 Bacteria 817
17 Ga0070673_100258719 3300005364 Bacteria 1520
18 Ga0070673_100707098 3300005364 Bacteria 926
19 Ga0070688_100127117 3300005365 Bacteria 1715
20 Ga0070659_100792296 3300005366 Bacteria 824
21 Ga0070709_10013408 3300005434 Bacteria 4608
22 Ga0070709_10186047 3300005434 Bacteria 1462
23 Ga0070713_100001562 3300005436 Bacteria 14645
24 Ga0070708_100234815 3300005445 Bacteria 1721
25 Ga0068867_100173142 3300005459 Bacteria 1711
26 Ga0068867_100268335 3300005459 Bacteria 1394
27 Ga0070685_10155218 3300005466 Bacteria 1454
28 Ga0070679_100407625 3300005530 Bacteria 1305
29 Ga0070679_100907209 3300005530 Bacteria 825
30 Ga0070684_100053611 3300005535 Bacteria 3512
31 Ga0068853_100040756 3300005539 Bacteria 3964
32 Ga0070672_100153207 3300005543 Bacteria 1908
33 Ga0070686_100246479 3300005544 Bacteria 1303
34 Ga0070693_100000570 3300005547 Bacteria 16368
35 Ga0070665_100035047 3300005548 Bacteria 5047
36 Ga0068855_100003613 3300005563 Bacteria 18900
37 Ga0068855_100042703 3300005563 Bacteria 5372
38 Ga0068855_100082871 3300005563 Bacteria 3716
39 Ga0068855_100085688 3300005563 Bacteria 3644
40 Ga0068855_100130870 3300005563 Bacteria 2866
41 Ga0068857_100131652 3300005577 Bacteria 2256
42 Ga0068856_100481674 3300005614 Bacteria 1262
43 Ga0070702_100314095 3300005615 Bacteria 1089
44 Ga0068852_100000171 3300005616 Bacteria 43711
45 Ga0068852_101007680 3300005616 Bacteria 852
46 Ga0068859_100096914 3300005617 Bacteria 3002
47 Ga0068863_100137192 3300005841 Bacteria 2337
48 Ga0068858_100057934 3300005842 Bacteria 3581
49 Ga0068858_100450103 3300005842 Bacteria 1241
50 Ga0075364_10249204 3300006051 Bacteria 1207
51 Ga0075432_10008395 3300006058 Bacteria 3522
52 Ga0070712_100781680 3300006175 Bacteria 818
53 Ga0075366_10025015 3300006195 Bacteria 3484
54 Ga0075366_10401659 3300006195 Bacteria 843
55 Ga0097621_100025103 3300006237 Bacteria 4660
56 Ga0097621_100029105 3300006237 Bacteria 4360
57 Ga0097621_100033163 3300006237 Bacteria 4110
58 Ga0068871_100044870 3300006358 Bacteria 3556
59 Ga0068871_100116817 3300006358 Bacteria 2249
60 Ga0075428_100076241 3300006844 Bacteria 3661
61 Ga0075429_100059676 3300006880 Bacteria 3323
62 Ga0068865_100403687 3300006881 Bacteria 1120
63 Ga0068865_100414947 3300006881 Bacteria 1105
64 Ga0097620_100096913 3300006931 Bacteria 3002
65 Ga0105240_10012879 3300009093 Bacteria 11518
66 Ga0105240_10103151 3300009093 Bacteria 3466
67 Ga0105240_10296870 3300009093 Bacteria 1850
68 Ga0105240_10548707 3300009093 Bacteria 1279
69 Ga0111539_10011114 3300009094 Bacteria 11328
70 Ga0105245_10082007 3300009098 Bacteria 2950
71 Ga0105245_10158325 3300009098 Bacteria 2147
72 Ga0114129_10397374 3300009147 Bacteria 1817
73 Ga0105243_10364290 3300009148 Bacteria 1331
74 Ga0105241_10155757 3300009174 Bacteria 1873
75 Ga0105241_10203368 3300009174 Bacteria 1655
76 Ga0105242_10179808 3300009176 Bacteria 1865
77 Ga0105242_10762372 3300009176 Bacteria 954
78 Ga0105248_10165610 3300009177 Bacteria 2493
79 Ga0105248_10165688 3300009177 Bacteria 2492
80 Ga0105238_10124269 3300009551 Bacteria 2560
81 Ga0105238_10251643 3300009551 Bacteria 1745
82 Ga0105238_10520991 3300009551 Bacteria 1191
83 Ga0105238_11465064 3300009551 Bacteria 711
84 Ga0105249_10171438 3300009553 Bacteria 2105
85 Ga0157370_10013852 3300013104 Bacteria 8282
86 Ga0157369_10002334 3300013105 Bacteria 22832
87 Ga0157378_10308974 3300013297 Bacteria 1533
88 Ga0163162_10094310 3300013306 Bacteria 3079
89 Ga0163162_10121874 3300013306 Bacteria 2712
90 Ga0163162_10974867 3300013306 Bacteria 958
91 Ga0157372_10003121 3300013307 Bacteria 17860
92 Ga0157380_10192983 3300014326 Bacteria 1800
93 Ga0157380_10344837 3300014326 Bacteria 1391
94 Ga0157380_10749358 3300014326 Bacteria 988
95 Ga0157377_10001897 3300014745 Bacteria 9156
96 Ga0157379_10144721 3300014968 Bacteria 2143
97 Ga0157376_10434138 3300014969 Bacteria 1277
98 Ga0207656_10001376 3300025321 Bacteria 8019
99 Ga0207692_10134007 3300025898 Bacteria 1402
100 Ga0207688_10113512 3300025901 Bacteria 1575
101 Ga0207699_10067401 3300025906 Bacteria 2176
102 Ga0207645_10152279 3300025907 Bacteria 1510
103 Ga0207643_10062691 3300025908 Bacteria 2124
104 Ga0207705_10042156 3300025909 Bacteria 3277
105 Ga0207705_10433447 3300025909 Bacteria 1018
106 Ga0207654_10430955 3300025911 Bacteria 922
107 Ga0207695_10464634 3300025913 Bacteria 1148
108 Ga0207663_10097372 3300025916 Bacteria 1968
109 Ga0207649_10260512 3300025920 Bacteria 1253
110 Ga0207652_10403524 3300025921 Bacteria 1233
111 Ga0207681_10508584 3300025923 Bacteria 987
112 Ga0207694_10629457 3300025924 Bacteria 903
113 Ga0207659_10022715 3300025926 Bacteria 4179
114 Ga0207659_10377781 3300025926 Bacteria 1181
115 Ga0207687_10090609 3300025927 Bacteria 2229
116 Ga0207687_10129587 3300025927 Bacteria 1899
117 Ga0207687_10726146 3300025927 Bacteria 844
118 Ga0207700_10059364 3300025928 Bacteria 2893
119 Ga0207690_10428398 3300025932 Bacteria 1060
120 Ga0207690_10727552 3300025932 Bacteria 817
121 Ga0207706_10495319 3300025933 Bacteria 1055
122 Ga0207686_10385063 3300025934 Bacteria 1064
123 Ga0207670_10179487 3300025936 Bacteria 1594
124 Ga0207669_10315766 3300025937 Bacteria 1194
125 Ga0207669_10317348 3300025937 Bacteria 1191
126 Ga0207669_10421523 3300025937 Bacteria 1051
127 Ga0207704_10103745 3300025938 Bacteria 1903
128 Ga0207704_10411754 3300025938 Bacteria 1069
129 Ga0207691_10166473 3300025940 Bacteria 1931
130 Ga0207711_10090737 3300025941 Bacteria 2687
131 Ga0207711_10239156 3300025941 Bacteria 1665
132 Ga0207689_10031092 3300025942 Bacteria 4447
133 Ga0207689_10122221 3300025942 Bacteria 2141
134 Ga0207667_10024970 3300025949 Bacteria 6552
135 Ga0207667_10033928 3300025949 Bacteria 5483
136 Ga0207667_10087688 3300025949 Bacteria 3219
137 Ga0207667_10342822 3300025949 Bacteria 1525
138 Ga0207651_10694798 3300025960 Bacteria 896
139 Ga0207640_10213807 3300025981 Bacteria 1471
140 Ga0207677_10144019 3300026023 Bacteria 1829
141 Ga0207703_10043910 3300026035 Bacteria 3589
142 Ga0207639_10206358 3300026041 Bacteria 1689
143 Ga0207708_10472866 3300026075 Bacteria 1047
144 Ga0207702_10631702 3300026078 Bacteria 1052
145 Ga0207648_10044452 3300026089 Bacteria 3897
146 Ga0207648_10139047 3300026089 Bacteria 2140
147 Ga0207648_10458365 3300026089 Bacteria 1162
148 Ga0207674_10028827 3300026116 Bacteria 5853
149 Ga0207683_10158150 3300026121 Bacteria 2047
150 Ga0207683_10210379 3300026121 Bacteria 1770
151 Ga0207683_10813575 3300026121 Bacteria 867
152 Ga0207698_10001729 3300026142 Bacteria 12735
153 Ga0207428_10007646 3300027907 Bacteria 9840
154 Ga0268266_10165013 3300028379 Bacteria 2006
155 Ga0268266_10899668 3300028379 Bacteria 856
156 Ga0307408_100213721 3300031548 Bacteria 1569
157 Ga0307412_10154789 3300031911 Bacteria 1696
158 Ga0307416_100062012 3300032002 Bacteria 3055
159 Ga0307416_100157934 3300032002 Bacteria 2091
160 Ga0307416_100213867 3300032002 Bacteria 1842
161 Ga0307416_100700595 3300032002 Bacteria 1102
162 Ga0373934_0106029 3300035086 Bacteria 1138
163 Ga0373954_0068006 3300035118 Bacteria 1689
164 Ga0373943_0160186 3300035170 Bacteria 1225
165 Ga0373955_0003209 3300035172 Bacteria 7165
166 Ga0373924_0028076 3300035410 Bacteria 2241
167 Ga0373931_0036767 3300035691 Bacteria 2554
168 Ga0373933_0045166 3300035724 Bacteria 2612
169 Ga0373937_0263571 3300036401 Bacteria 1625
170 Ga0395900_0140941 3300037418 Bacteria 2469
171 Ga0395905_0028382 3300037471 Bacteria 5276
172 Ga0395901_0031279 3300038443 Bacteria 5488
173 Ga0451807_1080169 3300041486 Bacteria 645
174 Ga0451577_0138577 3300042876 Bacteria 2185
175 Ga0466959_0230072 3300045049 Bacteria 1283
176 Ga0451576_0174683 3300045051 Bacteria 2243
177 Ga0495592_0034851 3300046454 Bacteria 3793
178 Ga0495653_0016102 3300046463 Bacteria 6092
179 Ga0495664_0032500 3300046477 Bacteria 3062
180 Ga0495608_0038506 3300046511 Bacteria 3210
181 Ga0495587_0002452 3300046536 Bacteria 12378
182 Ga0495645_0000615 3300046543 Bacteria 24594
183 Ga0495635_0067784 3300046663 Bacteria 2447
184 Ga0495599_0004532 3300046678 Bacteria 8238
185 Ga0495623_0011639 3300046679 Bacteria 5699
186 Ga0495600_0048177 3300046809 Bacteria 2780
187 Ga0496104_0021538 3300048907 Bacteria 5919
188 Ga0496110_0050659 3300048913 Bacteria 3647
189 Ga0496111_0282069 3300048914 Bacteria 1232
190 Ga0496126_0376664 3300048929 Bacteria 1156
191 Ga0501034_0047490 3300049571 Bacteria 4334
192 Ga0501034_0542122 3300049571 Bacteria 1073
193 nmdc:mga00v17_260911_c1 3300050491 Bacteria 1124
194 nmdc:mga00v17_335739_c1 3300050491 Bacteria 982
195 nmdc:mga0k408_5736_c1 3300050493 Bacteria 6604
196 nmdc:mga09592_69322_c1 3300050508 Bacteria 2991
197 nmdc:mga08y16_397078_c1 3300050511 Bacteria 1412
198 nmdc:mga08y16_433_c1 3300050511 Bacteria 38517
199 nmdc:mga0a205_125190_c1 3300050515 Bacteria 2469
200 Ga0495601_0008470 3300053077 Bacteria 6075
201 Ga0495619_0194919 3300053085 Bacteria 1402
202 Ga0500641_0020365 3300053096 Bacteria 2518
203 Ga0500562_120828 3300053108 Bacteria 714
204 2808984168 2808606386 Bacteria 4471946
205 2809131972 2808606415 Bacteria 4576710
206 2809151595 2808606419 Bacteria 4576925
207 2852622945 2852618963 Bacteria 4577824
208 8056215881 8056207758 Bacteria 8639239
209 Ga0068868_100054955
210 rootH2_10109436
211 Ga0065712_10082987
212 Ga0070658_10048849
213 Ga0070683_100185912
214 Ga0068869_100048019
215 Ga0068869_100163119
216 Ga0068868_100171406
217 Ga0070689_100001716
218 Ga0070689_100096319
219 Ga0070661_100200887
220 Ga0070661_100432819
221 Ga0070675_100005306
222 Ga0070671_100458690
223 Ga0070674_100557386
224 Ga0070674_100793857
225 Ga0070673_100258719
226 Ga0070673_100707098
227 Ga0070688_100127117
228 Ga0070659_100792296
229 Ga0070709_10013408
230 Ga0070709_10186047
231 Ga0070713_100001562
232 Ga0070708_100234815
233 Ga0068867_100173142
234 Ga0068867_100268335
235 Ga0070685_10155218
236 Ga0070679_100407625
237 Ga0070679_100907209
238 Ga0070684_100053611
239 Ga0068853_100040756
240 Ga0070672_100153207
241 Ga0070686_100246479
242 Ga0070693_100000570
243 Ga0070665_100035047
244 Ga0068855_100003613
245 Ga0068855_100042703
246 Ga0068855_100082871
247 Ga0068855_100085688
248 Ga0068855_100130870
249 Ga0068857_100131652
250 Ga0068856_100481674
251 Ga0070702_100314095
252 Ga0068852_100000171
253 Ga0068852_101007680
254 Ga0068859_100096914
255 Ga0068863_100137192
256 Ga0068858_100057934
257 Ga0068858_100450103
258 Ga0075364_10249204
259 Ga0075432_10008395
260 Ga0070712_100781680
261 Ga0075366_10025015
262 Ga0075366_10401659
263 Ga0097621_100025103
264 Ga0097621_100029105
265 Ga0097621_100033163
266 Ga0068871_100044870
267 Ga0068871_100116817
268 Ga0075428_100076241
269 Ga0075429_100059676
270 Ga0068865_100403687
271 Ga0068865_100414947
272 Ga0097620_100096913
273 Ga0105240_10012879
274 Ga0105240_10103151
275 Ga0105240_10296870
276 Ga0105240_10548707
277 Ga0111539_10011114
278 Ga0105245_10082007
279 Ga0105245_10158325
280 Ga0114129_10397374
281 Ga0105243_10364290
282 Ga0105241_10155757
283 Ga0105241_10203368
284 Ga0105242_10179808
285 Ga0105242_10762372
286 Ga0105248_10165610
287 Ga0105248_10165688
288 Ga0105238_10124269
289 Ga0105238_10251643
290 Ga0105238_10520991
291 Ga0105238_11465064
292 Ga0105249_10171438
293 Ga0157370_10013852
294 Ga0157369_10002334
295 Ga0157378_10308974
296 Ga0163162_10094310
297 Ga0163162_10121874
298 Ga0163162_10974867
299 Ga0157372_10003121
300 Ga0157380_10192983
301 Ga0157380_10344837
302 Ga0157380_10749358
303 Ga0157377_10001897
304 Ga0157379_10144721
305 Ga0157376_10434138
306 Ga0207656_10001376
307 Ga0207692_10134007
308 Ga0207688_10113512
309 Ga0207699_10067401
310 Ga0207645_10152279
311 Ga0207643_10062691
312 Ga0207705_10042156
313 Ga0207705_10433447
314 Ga0207654_10430955
315 Ga0207695_10464634
316 Ga0207663_10097372
317 Ga0207649_10260512
318 Ga0207652_10403524
319 Ga0207681_10508584
320 Ga0207694_10629457
321 Ga0207659_10022715
322 Ga0207659_10377781
323 Ga0207687_10090609
324 Ga0207687_10129587
325 Ga0207687_10726146
326 Ga0207700_10059364
327 Ga0207690_10428398
328 Ga0207690_10727552
329 Ga0207706_10495319
330 Ga0207686_10385063
331 Ga0207670_10179487
332 Ga0207669_10315766
333 Ga0207669_10317348
334 Ga0207669_10421523
335 Ga0207704_10103745
336 Ga0207704_10411754
337 Ga0207691_10166473
338 Ga0207711_10090737
339 Ga0207711_10239156
340 Ga0207689_10031092
341 Ga0207689_10122221
342 Ga0207667_10024970
343 Ga0207667_10033928
344 Ga0207667_10087688
345 Ga0207667_10342822
346 Ga0207651_10694798
347 Ga0207640_10213807
348 Ga0207677_10144019
349 Ga0207703_10043910
350 Ga0207639_10206358
351 Ga0207708_10472866
352 Ga0207702_10631702
353 Ga0207648_10044452
354 Ga0207648_10139047
355 Ga0207648_10458365
356 Ga0207674_10028827
357 Ga0207683_10158150
358 Ga0207683_10210379
359 Ga0207683_10813575
360 Ga0207698_10001729
361 Ga0207428_10007646
362 Ga0268266_10165013
363 Ga0268266_10899668
364 Ga0307408_100213721
365 Ga0307412_10154789
366 Ga0307416_100062012
367 Ga0307416_100157934
368 Ga0307416_100213867
369 Ga0307416_100700595
370 Ga0373934_0106029
371 Ga0373954_0068006
372 Ga0373943_0160186
373 Ga0373955_0003209
374 Ga0373924_0028076
375 Ga0373931_0036767
376 Ga0373933_0045166
377 Ga0373937_0263571
378 Ga0395900_0140941
379 Ga0395905_0028382
380 Ga0395901_0031279
381 Ga0451807_1080169
382 Ga0451577_0138577
383 Ga0466959_0230072
384 Ga0451576_0174683
385 Ga0495592_0034851
386 Ga0495653_0016102
387 Ga0495664_0032500
388 Ga0495608_0038506
389 Ga0495587_0002452
390 Ga0495645_0000615
391 Ga0495635_0067784
392 Ga0495599_0004532
393 Ga0495623_0011639
394 Ga0495600_0048177
395 Ga0496104_0021538
396 Ga0496110_0050659
397 Ga0496111_0282069
398 Ga0496126_0376664
399 Ga0501034_0047490
400 Ga0501034_0542122
401 nmdc:mga00v17_260911_c1
402 nmdc:mga00v17_335739_c1
403 nmdc:mga0k408_5736_c1
404 nmdc:mga09592_69322_c1
405 nmdc:mga08y16_397078_c1
406 nmdc:mga08y16_433_c1
407 nmdc:mga0a205_125190_c1
408 Ga0495601_0008470
409 Ga0495619_0194919
410 Ga0500641_0020365
411 Ga0500562_120828
412 2808984168
413 2809131972
414 2809151595
415 2852622945
416 8056215881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

15

209

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hik-assembly1.cif.gz_A the tpp-bound bril-slc19a1/fab/nb ternary complex 0.4712 10 213
7xq1-assembly1.cif.gz_A structure of hslc19a1+2'3'-cdas 0.4511 11 213
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.4381 11 211
7yuf-assembly1.cif.gz_R apo human spns2 0.4335 9 212
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.4247 10 211
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5504 41 209 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5463 7 209 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5343 41 209 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5321 6 209 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5291 7 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0F5LUI3-F1-model_v4 Threonine transporter RhtB (Threonine/homoserine/homoserine lactone efflux protein) 0.9828 3 215 GO:0005886
GO:0015171
AF-A0A0F5LUI3-F1-model_v4 Threonine transporter RhtB (Threonine/homoserine/homoserine lactone efflux protein) 0.9738 3 215 GO:0005886
GO:0015171
AF-Q8YEK9-F1-model_v4 Homoserine/homoserine lactone efflux protein 0.9699 4 214 GO:0005886
GO:0015171
AF-Q8YEK9-F1-model_v4 Homoserine/homoserine lactone efflux protein 0.9479 4 214 GO:0005886
GO:0015171
AF-A0A530QQA3-F1-model_v4 LysE family translocator 0.9435 3 176 GO:0005886
GO:0015171

Map