F317141

General Info

Members Datasets Scaffolds Average Seq Length
207 141 168 412

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2811994872|2812321923
Length 436
Sequence SSTGTPGGSSAAAASPAPGLSRRGLLGLALGAGAAGLAVGAAGGATAASAAARAEQTDAAASVYAFAGAHQAGITTPVQDHLHFASFDMMPGTGRDDLVSLLQDWTYAASRMTQGLDVSASGAVGGSPEAPPDDTGEAVGLPASGLTITFGFGPTLFEADGADRYGIAAQRPVSLERLPAFLGDDLDPSRSGGDLCIQACADDPQVAVHAVRNLSRIAFGRARLRWSQLGFGRTSRTTSAQATPRNLFGFKDGTANILASDTAALDEHVWVAASDEPAWMAGGSYLVARKIAMLVETWDRVRLSEQNAIIGRDKAKGAPLSGGEEFTEPDFQATDASGSASIDARSHVRLAHPSLNGGTRILRRGYNYVDGNNDLGRLDAGLFFLSYQRSPAQFITLQKALATDRMAEYIRHVGSGLWAVPGGVAAGSFVGSALFA

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221575 Microbacterium sp. Root61 Isolate Unclassified
5 2643221597 Microbacterium sp. Root180 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
8 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
9 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
10 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
11 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
12 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
13 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
14 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
15 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
16 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
17 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
18 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
19 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
20 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
21 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
22 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
23 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
24 2919069694 Microbacterium sp. 1154 Isolate Unclassified
25 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
26 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
27 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
28 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
29 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
30 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
31 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
32 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
33 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
137 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
138 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
139 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
140 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
141 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.16
Metatranscriptomes 0
Isolates 18.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 1.45
Rhizosphere 64.73
Stem 0
Stem Tuber 0
Unclassified 30.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100156791 3300005334 Bacteria 1769
2 Ga0070668_100000284 3300005347 Bacteria 33650
3 Ga0070668_100003030 3300005347 Bacteria 12429
4 Ga0070667_100001908 3300005367 Bacteria 18496
5 Ga0070663_100001246 3300005455 Bacteria 13999
6 Ga0070662_100054090 3300005457 Bacteria 2909
7 Ga0070662_100080298 3300005457 Bacteria 2428
8 Ga0070665_100094193 3300005548 Bacteria 3000
9 Ga0068860_100265202 3300005843 Bacteria 1675
10 Ga0068862_100007537 3300005844 Bacteria 9019
11 Ga0081538_10004982 3300005981 Bacteria 12098
12 Ga0081538_10006105 3300005981 Bacteria 10703
13 Ga0081538_10006343 3300005981 Bacteria 10438
14 Ga0081539_10002344 3300005985 Bacteria 27233
15 Ga0075365_10001449 3300006038 Bacteria 10760
16 Ga0075364_10009171 3300006051 Bacteria 5926
17 Ga0075367_10072200 3300006178 Bacteria 2077
18 Ga0111539_10195012 3300009094 Bacteria 2362
19 Ga0114129_10034859 3300009147 Bacteria 7110
20 Ga0105248_10076675 3300009177 Bacteria 3757
21 Ga0105249_10015941 3300009553 Bacteria 6660
22 Ga0157369_10014028 3300013105 Bacteria 9052
23 Ga0171462_1001 3300013250 Bacteria 1135406
24 Ga0157377_10036946 3300014745 Bacteria 2689
25 Ga0157379_10034406 3300014968 Bacteria 4518
26 Ga0207706_10012718 3300025933 Bacteria 7661
27 Ga0207668_10006261 3300025972 Bacteria 7031
28 Ga0207668_10021800 3300025972 Bacteria 4090
29 Ga0207658_10016277 3300025986 Bacteria 5113
30 Ga0207678_10001383 3300026067 Bacteria 22317
31 Ga0207641_10339697 3300026088 Bacteria 1429
32 Ga0268266_10025720 3300028379 Bacteria 5009
33 Ga0268265_10015422 3300028380 Bacteria 5229
34 Ga0265337_1000537 3300028556 Bacteria 20203
35 Ga0265326_10000025 3300028558 Bacteria 112357
36 Ga0265322_10000004 3300028654 Bacteria 275155
37 Ga0307515_10102451 3300028794 Bacteria 3443
38 Ga0265324_10000315 3300029957 Bacteria 35483
39 Ga0265328_10005069 3300031239 Bacteria 5673
40 Ga0265320_10000051 3300031240 Bacteria 114823
41 Ga0265331_10001378 3300031250 Bacteria 17883
42 Ga0265327_10000226 3300031251 Bacteria 114821
43 Ga0265316_10014293 3300031344 Bacteria 6994
44 Ga0307408_100015936 3300031548 Bacteria 5011
45 Ga0265313_10073669 3300031595 Bacteria 1567
46 Ga0265314_10000146 3300031711 Bacteria 105474
47 Ga0307518_10000551 3300031838 Bacteria 28562
48 Ga0307518_10029521 3300031838 Bacteria 3970
49 Ga0307410_10138759 3300031852 Bacteria 1796
50 Ga0307406_10000115 3300031901 Bacteria 46616
51 Ga0307406_10000263 3300031901 Bacteria 31677
52 Ga0307406_10002208 3300031901 Bacteria 10595
53 Ga0307407_10050014 3300031903 Bacteria 2389
54 Ga0307407_10108445 3300031903 Bacteria 1738
55 Ga0307412_10120095 3300031911 Bacteria 1891
56 Ga0307409_100113103 3300031995 Bacteria 2281
57 Ga0307414_10005531 3300032004 Bacteria 6966
58 Ga0307415_100013345 3300032126 Bacteria 4793
59 Ga0307415_100097889 3300032126 Bacteria 2143
60 Ga0307507_10016662 3300033179 Bacteria 8520
61 Ga0439463_002088 3300042016 Bacteria 5170
62 Ga0439460_0024692 3300042461 Bacteria 1667
63 Ga0466972_0061036 3300044658 Bacteria 1808
64 Ga0466970_0043233 3300044765 Bacteria 2397
65 Ga0495652_0000037 3300046529 Bacteria 133232
66 Ga0496104_0101695 3300048907 Bacteria 2752
67 Ga0496105_0002429 3300048908 Bacteria 13502
68 Ga0496109_0183857 3300048912 Bacteria 1964
69 Ga0496117_0000028 3300048920 Bacteria 407392
70 Ga0496117_0000676 3300048920 Bacteria 54490
71 Ga0496117_0009549 3300048920 Bacteria 8998
72 Ga0496118_0006370 3300048921 Bacteria 13006
73 Ga0496118_0025257 3300048921 Bacteria 5101
74 Ga0496118_0108123 3300048921 Bacteria 1855
75 Ga0496119_0003338 3300048922 Bacteria 16720
76 Ga0496119_0004215 3300048922 Bacteria 14439
77 Ga0496119_0004444 3300048922 Bacteria 13956
78 Ga0496119_0005229 3300048922 Bacteria 12516
79 Ga0496119_0009563 3300048922 Bacteria 8289
80 Ga0496119_0012973 3300048922 Bacteria 6697
81 Ga0496120_0002231 3300048923 Bacteria 20317
82 Ga0496120_0008919 3300048923 Bacteria 7183
83 Ga0496121_0001897 3300048924 Bacteria 33498
84 Ga0496121_0020586 3300048924 Bacteria 6515
85 Ga0496122_0006207 3300048925 Bacteria 13863
86 Ga0496122_0006803 3300048925 Bacteria 12984
87 Ga0496122_0024110 3300048925 Bacteria 5333
88 Ga0496122_0134724 3300048925 Bacteria 1560
89 Ga0496123_0000879 3300048926 Bacteria 47728
90 Ga0496123_0001962 3300048926 Bacteria 26720
91 Ga0496123_0037926 3300048926 Bacteria 3396
92 Ga0496124_0035094 3300048927 Bacteria 4391
93 Ga0496125_0002853 3300048928 Bacteria 21750
94 Ga0496125_0007769 3300048928 Bacteria 11350
95 Ga0496125_0010739 3300048928 Bacteria 9223
96 Ga0496125_0021942 3300048928 Bacteria 5938
97 Ga0496125_0039662 3300048928 Bacteria 4051
98 Ga0496125_0049333 3300048928 Bacteria 3499
99 Ga0496125_0078584 3300048928 Bacteria 2535
100 Ga0496126_0033502 3300048929 Bacteria 4832
101 Ga0496126_0054554 3300048929 Bacteria 3619
102 Ga0501031_0002789 3300049568 Bacteria 11142
103 Ga0501031_0034387 3300049568 Bacteria 3307
104 Ga0501033_0095798 3300049570 Bacteria 2169
105 Ga0501033_0138818 3300049570 Bacteria 1758
106 Ga0501036_0017823 3300049572 Bacteria 5943
107 Ga0501036_0082614 3300049572 Bacteria 2715
108 Ga0501037_0037187 3300049573 Bacteria 3588
109 Ga0501038_0001160 3300049574 Bacteria 23904
110 Ga0501038_0002340 3300049574 Bacteria 17665
111 Ga0501038_0197449 3300049574 Bacteria 1616
112 Ga0501039_0000854 3300049575 Bacteria 22023
113 Ga0501039_0000874 3300049575 Bacteria 21850
114 Ga0501040_0000040 3300049576 Bacteria 58872
115 Ga0501040_0000318 3300049576 Bacteria 28390
116 Ga0501040_0068455 3300049576 Bacteria 2448
117 Ga0501041_0001657 3300049577 Bacteria 12460
118 Ga0501042_0000007 3300049578 Bacteria 63673
119 Ga0501042_0000071 3300049578 Bacteria 37532
120 Ga0501043_0030799 3300049579 Bacteria 4219
121 Ga0501043_0071740 3300049579 Bacteria 2720
122 Ga0501046_0012551 3300049580 Bacteria 7205
123 Ga0501046_0096870 3300049580 Bacteria 2266
124 Ga0501048_0000257 3300049582 Bacteria 35455
125 Ga0501048_0010302 3300049582 Bacteria 6987
126 Ga0501067_0094268 3300049583 Bacteria 1662
127 Ga0501071_0000418 3300049587 Bacteria 21141
128 Ga0501071_0032634 3300049587 Bacteria 3698
129 Ga0501072_0024592 3300049588 Bacteria 4687
130 Ga0501072_0026087 3300049588 Bacteria 4553
131 Ga0501072_0027822 3300049588 Bacteria 4411
132 Ga0501072_0090958 3300049588 Bacteria 2422
133 Ga0501074_0000378 3300049590 Bacteria 26372
134 Ga0501074_0007154 3300049590 Bacteria 8061
135 Ga0501075_0055507 3300049591 Bacteria 2980
136 Ga0501076_0000023 3300049592 Bacteria 79158
137 Ga0501076_0002866 3300049592 Bacteria 11935
138 Ga0501076_0089237 3300049592 Bacteria 2478
139 Ga0501077_0000339 3300049593 Bacteria 27568
140 Ga0501077_0028944 3300049593 Bacteria 3521
141 Ga0501077_0065114 3300049593 Bacteria 2311
142 Ga0501079_0000170 3300049741 Bacteria 36419
143 Ga0501079_0016009 3300049741 Bacteria 5729
144 Ga0501080_0088469 3300049742 Bacteria 2877
145 Ga0501080_0091222 3300049742 Bacteria 2830
146 Ga0501080_0092536 3300049742 Bacteria 2808
147 Ga0501081_0000070 3300049743 Bacteria 39402
148 Ga0501081_0003937 3300049743 Bacteria 9517
149 Ga0501083_0022710 3300049744 Bacteria 4353
150 Ga0501083_0033059 3300049744 Bacteria 3543
151 Ga0501035_0031871 3300049822 Bacteria 4800
152 Ga0501035_0042946 3300049822 Bacteria 4075
153 Ga0501044_0238930 3300049823 Bacteria 1761
154 Ga0501045_0000015 3300049824 Bacteria 72669
155 Ga0501045_0010277 3300049824 Bacteria 6555
156 Ga0501045_0051006 3300049824 Bacteria 3019
157 nmdc:mga00v17_27495_c1 3300050491 Bacteria 3321
158 nmdc:mga0yw44_1006_c1 3300050492 Bacteria 10784
159 nmdc:mga06z11_15178_c1 3300050494 Bacteria 3432
160 nmdc:mga0a205_213420_c1 3300050515 Bacteria 1817
161 Ga0501084_0000738 3300054114 Bacteria 24966
162 Ga0590075_004331 3300059424 Bacteria 3361
163 Ga0501082_0000134 3300060353 Bacteria 60619
164 Ga0501082_0010367 3300060353 Bacteria 8024
165 Ga0501082_0052257 3300060353 Bacteria 3522
166 Ga0530510_0000375 3300061734 Bacteria 29049
167 Ga0530510_0007071 3300061734 Bacteria 7810
168 Ga0530510_0066230 3300061734 Bacteria 2618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100054090 Ga0070662_1000540902 342
2 3300025933 Ga0207706_10012718 Ga0207706_100127186 360
3 3300049822 Ga0501035_0031871 Ga0501035_0031871_2338_3444 360
4 3300031548 Ga0307408_100015936 Ga0307408_1000159362 366
5 3300031903 Ga0307407_10108445 Ga0307407_101084452 366
6 iso_pu_bacteria 2984542743 2984546099 369
7 3300048924 Ga0496121_0001897 Ga0496121_0001897_24371_25606 371
8 3300006051 Ga0075364_10009171 Ga0075364_100091714 375
9 3300050491 nmdc:mga00v17_27495_c1 nmdc:mga00v17_27495_c1_608_1828 375
10 3300042016 Ga0439463_002088 Ga0439463_002088_1239_2507 379
11 3300032126 Ga0307415_100097889 Ga0307415_1000978892 380
12 3300031911 Ga0307412_10120095 Ga0307412_101200952 381
13 3300042461 Ga0439460_0024692 Ga0439460_0024692_311_1579 381
14 3300005981 Ga0081538_10004982 Ga0081538_1000498210 384
15 3300032126 Ga0307415_100013345 Ga0307415_1000133453 387
16 3300044658 Ga0466972_0061036 Ga0466972_0061036_46_1305 387
17 3300044765 Ga0466970_0043233 Ga0466970_0043233_1009_2268 387
18 3300033179 Ga0307507_10016662 Ga0307507_100166623 388
19 3300048908 Ga0496105_0002429 Ga0496105_0002429_1789_3018 389
20 3300048920 Ga0496117_0009549 Ga0496117_0009549_6411_7586 389
21 3300048921 Ga0496118_0025257 Ga0496118_0025257_3285_4460 389
22 3300048922 Ga0496119_0003338 Ga0496119_0003338_6455_7684 389
23 3300049578 Ga0501042_0000071 Ga0501042_0000071_15336_16592 389
24 3300048912 Ga0496109_0183857 Ga0496109_0183857_715_1950 390
25 3300048924 Ga0496121_0020586 Ga0496121_0020586_3370_4605 390
26 3300048928 Ga0496125_0078584 Ga0496125_0078584_443_1678 390
27 3300049573 Ga0501037_0037187 Ga0501037_0037187_210_1469 390
28 3300049574 Ga0501038_0001160 Ga0501038_0001160_4380_5639 390
29 3300049575 Ga0501039_0000854 Ga0501039_0000854_2759_4018 390
30 3300049576 Ga0501040_0000318 Ga0501040_0000318_24531_25790 390
31 3300049576 Ga0501040_0068455 Ga0501040_0068455_740_2047 390
32 3300049579 Ga0501043_0030799 Ga0501043_0030799_799_2058 390
33 3300049580 Ga0501046_0012551 Ga0501046_0012551_3605_4864 390
34 3300049582 Ga0501048_0010302 Ga0501048_0010302_3369_4628 390
35 3300049587 Ga0501071_0000418 Ga0501071_0000418_2255_3514 390
36 3300049588 Ga0501072_0026087 Ga0501072_0026087_431_1690 390
37 3300049590 Ga0501074_0007154 Ga0501074_0007154_1736_2995 390
38 3300049592 Ga0501076_0002866 Ga0501076_0002866_2392_3651 390
39 3300049593 Ga0501077_0000339 Ga0501077_0000339_299_1558 390
40 3300049741 Ga0501079_0016009 Ga0501079_0016009_2208_3467 390
41 3300049742 Ga0501080_0092536 Ga0501080_0092536_1461_2720 390
42 3300049743 Ga0501081_0003937 Ga0501081_0003937_4229_5488 390
43 3300049744 Ga0501083_0022710 Ga0501083_0022710_397_1656 390
44 3300049823 Ga0501044_0238930 Ga0501044_0238930_99_1358 390
45 3300049824 Ga0501045_0010277 Ga0501045_0010277_292_1551 390
46 3300054114 Ga0501084_0000738 Ga0501084_0000738_2196_3455 390
47 3300060353 Ga0501082_0010367 Ga0501082_0010367_2246_3505 390
48 3300061734 Ga0530510_0000375 Ga0530510_0000375_2392_3651 390
49 3300005981 Ga0081538_10006343 Ga0081538_100063437 391
50 3300009553 Ga0105249_10015941 Ga0105249_100159415 391
51 3300031852 Ga0307410_10138759 Ga0307410_101387592 391
52 3300031901 Ga0307406_10002208 Ga0307406_100022086 391
53 3300031995 Ga0307409_100113103 Ga0307409_1001131033 391
54 3300032004 Ga0307414_10005531 Ga0307414_100055315 391
55 3300048907 Ga0496104_0101695 Ga0496104_0101695_29_1318 391
56 3300048922 Ga0496119_0005229 Ga0496119_0005229_8638_9975 391
57 3300049588 Ga0501072_0024592 Ga0501072_0024592_658_1965 391
58 3300049592 Ga0501076_0089237 Ga0501076_0089237_765_2072 391
59 3300059424 Ga0590075_004331 Ga0590075_004331_186_1451 391
60 3300028794 Ga0307515_10102451 Ga0307515_101024513 392
61 3300005981 Ga0081538_10006105 Ga0081538_100061056 393
62 3300048928 Ga0496125_0007769 Ga0496125_0007769_4185_5453 393
63 3300031901 Ga0307406_10000263 Ga0307406_100002636 394
64 3300031903 Ga0307407_10050014 Ga0307407_100500142 394
65 3300026088 Ga0207641_10339697 Ga0207641_103396971 396
66 3300031838 Ga0307518_10029521 Ga0307518_100295212 396
67 3300049583 Ga0501067_0094268 Ga0501067_0094268_270_1535 396
68 3300005347 Ga0070668_100000284 Ga0070668_10000028423 397
69 3300009177 Ga0105248_10076675 Ga0105248_100766754 397
70 3300025972 Ga0207668_10021800 Ga0207668_100218002 397
71 3300028556 Ga0265337_1000537 Ga0265337_100053716 397
72 3300028558 Ga0265326_10000025 Ga0265326_100000258 397
73 3300028654 Ga0265322_10000004 Ga0265322_10000004226 397
74 3300029957 Ga0265324_10000315 Ga0265324_1000031520 397
75 3300031239 Ga0265328_10005069 Ga0265328_100050692 397
76 3300031240 Ga0265320_10000051 Ga0265320_1000005164 397
77 3300031250 Ga0265331_10001378 Ga0265331_1000137814 397
78 3300031251 Ga0265327_10000226 Ga0265327_1000022664 397
79 3300031344 Ga0265316_10014293 Ga0265316_100142936 397
80 3300031595 Ga0265313_10073669 Ga0265313_100736691 397
81 3300031711 Ga0265314_10000146 Ga0265314_1000014657 397
82 3300031901 Ga0307406_10000115 Ga0307406_1000011524 397
83 3300048920 Ga0496117_0000676 Ga0496117_0000676_13966_15234 398
84 3300048925 Ga0496122_0134724 Ga0496122_0134724_96_1406 398
85 3300048928 Ga0496125_0039662 Ga0496125_0039662_1218_2528 398
86 3300005985 Ga0081539_10002344 Ga0081539_1000234423 399
87 3300013250 Ga0171462_1001 Ga0171462_100187 399
88 3300048922 Ga0496119_0009563 Ga0496119_0009563_2741_4042 399
89 3300048928 Ga0496125_0010739 Ga0496125_0010739_1342_2658 399
90 3300005347 Ga0070668_100003030 Ga0070668_1000030308 400
91 3300005367 Ga0070667_100001908 Ga0070667_1000019084 400
92 3300005548 Ga0070665_100094193 Ga0070665_1000941931 400
93 3300005843 Ga0068860_100265202 Ga0068860_1002652022 400
94 3300005844 Ga0068862_100007537 Ga0068862_1000075376 400
95 3300013105 Ga0157369_10014028 Ga0157369_100140283 400
96 3300014968 Ga0157379_10034406 Ga0157379_100344066 400
97 3300025972 Ga0207668_10006261 Ga0207668_100062614 400
98 3300025986 Ga0207658_10016277 Ga0207658_100162772 400
99 3300028380 Ga0268265_10015422 Ga0268265_100154226 400
100 3300046529 Ga0495652_0000037 Ga0495652_0000037_115724_116956 400
101 3300048921 Ga0496118_0006370 Ga0496118_0006370_9762_11075 400
102 3300048925 Ga0496122_0006207 Ga0496122_0006207_5290_6603 400
103 3300048928 Ga0496125_0021942 Ga0496125_0021942_4282_5595 400
104 3300048921 Ga0496118_0108123 Ga0496118_0108123_28_1263 401
105 3300048922 Ga0496119_0004215 Ga0496119_0004215_4565_5800 401
106 3300048925 Ga0496122_0024110 Ga0496122_0024110_2482_3804 401
107 3300048926 Ga0496123_0000879 Ga0496123_0000879_42403_43725 401
108 3300048928 Ga0496125_0049333 Ga0496125_0049333_387_1709 401
109 3300048929 Ga0496126_0033502 Ga0496126_0033502_72_1394 401
110 3300005455 Ga0070663_100001246 Ga0070663_10000124612 402
111 3300006038 Ga0075365_10001449 Ga0075365_100014498 402
112 3300006178 Ga0075367_10072200 Ga0075367_100722002 402
113 3300026067 Ga0207678_10001383 Ga0207678_1000138314 402
114 3300049568 Ga0501031_0002789 Ga0501031_0002789_9834_11087 402
115 3300049570 Ga0501033_0138818 Ga0501033_0138818_280_1533 402
116 3300049572 Ga0501036_0017823 Ga0501036_0017823_602_1855 402
117 3300049574 Ga0501038_0002340 Ga0501038_0002340_8870_10123 402
118 3300049575 Ga0501039_0000874 Ga0501039_0000874_14652_15905 402
119 3300049576 Ga0501040_0000040 Ga0501040_0000040_38123_39376 402
120 3300049577 Ga0501041_0001657 Ga0501041_0001657_5496_6749 402
121 3300049578 Ga0501042_0000007 Ga0501042_0000007_53372_54625 402
122 3300049582 Ga0501048_0000257 Ga0501048_0000257_8188_9441 402
123 3300049588 Ga0501072_0027822 Ga0501072_0027822_1061_2314 402
124 3300049590 Ga0501074_0000378 Ga0501074_0000378_5978_7231 402
125 3300049592 Ga0501076_0000023 Ga0501076_0000023_67560_68813 402
126 3300049593 Ga0501077_0065114 Ga0501077_0065114_612_1865 402
127 3300049741 Ga0501079_0000170 Ga0501079_0000170_16611_17864 402
128 3300049742 Ga0501080_0091222 Ga0501080_0091222_473_1726 402
129 3300049743 Ga0501081_0000070 Ga0501081_0000070_23688_24941 402
130 3300049824 Ga0501045_0000015 Ga0501045_0000015_33286_34539 402
131 3300050492 nmdc:mga0yw44_1006_c1 nmdc:mga0yw44_1006_c1_6971_8197 402
132 3300050494 nmdc:mga06z11_15178_c1 nmdc:mga06z11_15178_c1_923_2149 402
133 3300060353 Ga0501082_0000134 Ga0501082_0000134_44322_45575 402
134 3300061734 Ga0530510_0007071 Ga0530510_0007071_4547_5800 402
135 3300048928 Ga0496125_0002853 Ga0496125_0002853_3543_4823 404
136 3300048929 Ga0496126_0054554 Ga0496126_0054554_1653_2933 404
137 3300048920 Ga0496117_0000028 Ga0496117_0000028_337103_338383 405
138 3300048922 Ga0496119_0004444 Ga0496119_0004444_3544_4824 405
139 3300048923 Ga0496120_0008919 Ga0496120_0008919_3478_4758 405
140 3300048926 Ga0496123_0001962 Ga0496123_0001962_3467_4747 405
141 3300048927 Ga0496124_0035094 Ga0496124_0035094_1768_3048 405
142 3300028379 Ga0268266_10025720 Ga0268266_100257203 406
143 iso_pu_bacteria 2808606306 2808630969 406
144 iso_pu_bacteria 2917736166 2917739850 410
145 iso_pu_bacteria 8003314358 8003318225 410
146 iso_pu_bacteria 8047710418 8047715264 411
147 iso_pu_bacteria 2585427649 2586058185 412
148 iso_pu_bacteria 2808606522 2809592973 412
149 iso_pu_bacteria 2915768154 2915768240 412
150 iso_pu_bacteria 2905926851 2905930494 413
151 3300031838 Ga0307518_10000551 Ga0307518_1000055110 416
152 3300049744 Ga0501083_0033059 Ga0501083_0033059_1108_2367 418
153 iso_pu_bacteria 2773857758 2774381461 419
154 iso_pu_bacteria 2904509784 2904509856 419
155 iso_pu_bacteria 2908678064 2908678931 419
156 iso_pu_bacteria 2919069694 2919071279 419
157 iso_pu_bacteria 2977228692 2977230832 419
158 iso_pu_bacteria 2977236895 2977239629 419
159 iso_pu_bacteria 2977264416 2977266061 419
160 iso_pu_bacteria 2757320536 2758224267 420
161 iso_pu_bacteria 2946041624 2946043815 420
162 iso_pu_bacteria 2643221542 2643734015 421
163 iso_pu_bacteria 2643221553 2643785418 421
164 iso_pu_bacteria 2643221630 2644170593 421
165 iso_pu_bacteria 2643221724 2644679773 421
166 iso_pu_bacteria 2728369380 2730229298 421
167 iso_pu_bacteria 2747842429 2747955077 421
168 iso_pu_bacteria 2852663356 2852664876 421
169 iso_pu_bacteria 2857723135 2857723461 421
170 iso_pu_bacteria 2945968032 2945971464 421
171 iso_pu_bacteria 2946080515 2946081291 421
172 iso_pu_bacteria 8004182704 8004185480 421
173 iso_pu_bacteria 8055037949 8055038433 421
174 3300048922 Ga0496119_0012973 Ga0496119_0012973_5338_6627 422
175 3300048923 Ga0496120_0002231 Ga0496120_0002231_4121_5410 422
176 3300048925 Ga0496122_0006803 Ga0496122_0006803_10278_11567 422
177 3300048926 Ga0496123_0037926 Ga0496123_0037926_1939_3228 422
178 iso_pu_bacteria 2974324384 2974325885 422
179 iso_pu_bacteria 8016254467 8016254545 422
180 iso_pu_bacteria 2833709550 2833710432 423
181 iso_pu_bacteria 2643221597 2643995259 424
182 iso_pu_bacteria 2643221575 2643888683 425
183 iso_pu_bacteria 2857729791 2857730325 425
184 iso_pu_bacteria 2928121344 2928123540 425
185 iso_pu_bacteria 8045830549 8045832535 425
186 iso_pu_bacteria 2811994872 2812321923 426
187 3300009147 Ga0114129_10034859 Ga0114129_100348594 427
188 3300049568 Ga0501031_0034387 Ga0501031_0034387_310_1602 429
189 3300049570 Ga0501033_0095798 Ga0501033_0095798_550_1842 429
190 3300049572 Ga0501036_0082614 Ga0501036_0082614_1258_2550 429
191 3300049574 Ga0501038_0197449 Ga0501038_0197449_170_1462 429
192 3300049579 Ga0501043_0071740 Ga0501043_0071740_1135_2427 429
193 3300049580 Ga0501046_0096870 Ga0501046_0096870_196_1488 429
194 3300049587 Ga0501071_0032634 Ga0501071_0032634_816_2108 429
195 3300049588 Ga0501072_0090958 Ga0501072_0090958_1049_2341 429
196 3300049591 Ga0501075_0055507 Ga0501075_0055507_1110_2402 429
197 3300049593 Ga0501077_0028944 Ga0501077_0028944_265_1557 429
198 3300049742 Ga0501080_0088469 Ga0501080_0088469_1472_2764 429
199 3300049822 Ga0501035_0042946 Ga0501035_0042946_1040_2332 429
200 3300049824 Ga0501045_0051006 Ga0501045_0051006_919_2211 429
201 3300060353 Ga0501082_0052257 Ga0501082_0052257_1015_2307 429
202 3300061734 Ga0530510_0066230 Ga0530510_0066230_1185_2477 429
203 3300005334 Ga0068869_100156791 Ga0068869_1001567912 430
204 3300005457 Ga0070662_100080298 Ga0070662_1000802983 430
205 3300009094 Ga0111539_10195012 Ga0111539_101950122 430
206 3300014745 Ga0157377_10036946 Ga0157377_100369462 430
207 3300050515 nmdc:mga0a205_213420_c1 nmdc:mga0a205_213420_c1_38_1330 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04261

Dyp_perox_N

Dyp-type peroxidase, N-terminal

71

232

0.96

PF20628

Dyp_perox_C

Dyp-type peroxidase, C-terminal

243

425

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8rgy-assembly1.cif.gz_A serial synchrotron in plate room temperature structure of dye type peroxidase aa, 8 drops merged 0.9691 57 430
6i8i-assembly1.cif.gz_A dye type peroxidase aa from streptomyces lividans: 98.4 kgy structure 0.9684 57 429
4grc-assembly1.cif.gz_A-2 crystal structure of dyp-type peroxidase (sco2276) from streptomyces coelicolor 0.9665 57 430
8rgy-assembly1.cif.gz_A serial synchrotron in plate room temperature structure of dye type peroxidase aa, 8 drops merged 0.9638 57 430
4grc-assembly1.cif.gz_A-2 crystal structure of dyp-type peroxidase (sco2276) from streptomyces coelicolor 0.9638 57 430
ID Description Score Start End Superfamily
af_P90953_206_321_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7142 355 381 3.30.450.20
af_A0A0A0MPV6_457_568_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.701 189 214 2.30.29.30
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.6823 72 227 3.30.70.1030
af_Q9LR29_71_274_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6823 189 211 3.40.640.10
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6539 76 224 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y9GQK9-F1-model_v4 Deferrochelatase (EC 1.11.1.-) (Peroxidase EfeB) 0.9887 58 430 GO:0004601
GO:0005829
GO:0016829
GO:0020037
GO:0030313
GO:0033212
GO:0046872
AF-A0A1N0DUQ4-F1-model_v4 deleted 0.9819 97 430
AF-A0A1I1IXD9-F1-model_v4 Deferrochelatase (EC 1.11.1.-) (Peroxidase EfeB) 0.9794 58 429 GO:0004601
GO:0005829
GO:0020037
GO:0030313
GO:0033212
GO:0046872
AF-A0A7X6EIA9-F1-model_v4 deleted 0.9782 99 303
AF-A0A449GX03-F1-model_v4 Probable deferrochelatase/peroxidase EfeN (EC 1.11.1.-) 0.9767 97 430 GO:0004601
GO:0005829
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.5 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map