F316931

General Info

Members Datasets Scaffolds Average Seq Length
207 126 414 521

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0046867|Ga0495674_0046867_1645_3351
Length 568
Sequence VSRPFRINHASIRTFHRPTPLTAKANVRRAPSAERKGRMRSTIGAALIVLLTALVVAGTAGAKQVKTGGTLNVDLATDVDYTDPSLSYLSTGWELEYATCLKLVNYPDANGPRASQLVPEASSGFPKVSKDGKTYDFTVAAGFTKFSNGQPVTAASFKAALDRDADPKMQSPSGAFMSDIVGANTSPVSGVRVKGNHLLITMTHAAPDLLARLAMPFFCAVPASLPHDPNGVDTPPSAGPYYVSSRVANRSIVLKRNPYYKGKRPHNANQIDYTVGNSLDATYLRVQQGATDYAAGGIPPASYAEAAQKYGINKGQFWVKPLLNTSYLAFNTSRGVFKNNIALRKAVNQVIDRRAMLSQSGFLAGKRTDQILPPGIAGFRDADLYPLQQPNIKAAQKLAKGHTGDGNVVLYEGNRGASPLRAQIVQFNLKQIGLDVNITLLPRAVQIQKEGTRGEPFDIADESWGADYADPYDFINVLLDGKNIQDSNNNNFSYFNDPKFNAQMTQASLLSGNPRYTAYGNLDVAIMQQAVPWAPRANANNRMLVSKRFGCFTYSAIYTVDLAAACLK

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
46 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
88 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.34
Metatranscriptomes 9.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.39
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 15.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0046867 3300047319 Bacteria 3835
2 Ga0007417J51691_1029907 3300003544 Bacteria 1667
3 Ga0058861_10011057 3300004800 Bacteria 1716
4 Ga0058860_12082304 3300004801 Unclassified 1983
5 Ga0058862_10015162 3300004803 Bacteria 1962
6 Ga0058862_10108407 3300004803 Bacteria 1782
7 Ga0058862_10203476 3300004803 Unclassified 1773
8 Ga0070683_100004401 3300005329 Bacteria 11600
9 Ga0070683_100054286 3300005329 Bacteria 3715
10 Ga0068868_100121785 3300005338 Bacteria 2128
11 Ga0070660_100005605 3300005339 Bacteria 8703
12 Ga0070660_100020982 3300005339 Bacteria 4810
13 Ga0070671_100011266 3300005355 Bacteria 7184
14 Ga0070711_100116692 3300005439 Unclassified 1967
15 Ga0070694_100044136 3300005444 Bacteria 2983
16 Ga0070708_100013699 3300005445 Bacteria 6652
17 Ga0070678_100047542 3300005456 Bacteria 3084
18 Ga0070681_10008751 3300005458 Bacteria 9932
19 Ga0070681_10057530 3300005458 Bacteria 3868
20 Ga0070681_10064927 3300005458 Bacteria 3620
21 Ga0070679_100012133 3300005530 Bacteria 8233
22 Ga0070679_100067037 3300005530 Bacteria 3579
23 Ga0068855_100070933 3300005563 Bacteria 4052
24 Ga0081455_10019751 3300005937 Bacteria 6365
25 Ga0081455_10048534 3300005937 Bacteria 3667
26 Ga0097621_100086179 3300006237 Bacteria 2621
27 Ga0075434_100019104 3300006871 Bacteria 6624
28 Ga0075436_100056447 3300006914 Bacteria 2712
29 Ga0075436_100082660 3300006914 Unclassified 2228
30 Ga0111539_10285334 3300009094 Bacteria 1921
31 Ga0114129_10110849 3300009147 Bacteria 3788
32 Ga0105243_10087160 3300009148 Unclassified 2562
33 Ga0105243_10133145 3300009148 Unclassified 2112
34 Ga0105248_10046864 3300009177 Bacteria 4847
35 Ga0157369_10036561 3300013105 Bacteria 5379
36 Ga0157369_10220881 3300013105 Unclassified 1984
37 Ga0157372_10088692 3300013307 Bacteria 3512
38 Ga0157375_10085825 3300013308 Bacteria 3198
39 Ga0157376_10065019 3300014969 Bacteria 3078
40 Ga0224712_10031428 3300022467 Bacteria 1926
41 Ga0207707_10038235 3300025912 Bacteria 4194
42 Ga0207707_10039213 3300025912 Bacteria 4141
43 Ga0207707_10092114 3300025912 Bacteria 2649
44 Ga0207707_10116895 3300025912 Bacteria 2331
45 Ga0207657_10023823 3300025919 Bacteria 5689
46 Ga0207657_10048745 3300025919 Bacteria 3697
47 Ga0207652_10006523 3300025921 Bacteria 9407
48 Ga0207652_10189618 3300025921 Bacteria 1849
49 Ga0207700_10037893 3300025928 Bacteria 3496
50 Ga0207700_10175626 3300025928 Unclassified 1790
51 Ga0207686_10075647 3300025934 Unclassified 2180
52 Ga0207709_10056604 3300025935 Unclassified 2427
53 Ga0207709_10073105 3300025935 Unclassified 2183
54 Ga0207704_10110710 3300025938 Bacteria 1855
55 Ga0207661_10051393 3300025944 Bacteria 3289
56 Ga0207679_10089573 3300025945 Unclassified 2375
57 Ga0207667_10064584 3300025949 Bacteria 3820
58 Ga0207674_10144893 3300026116 Bacteria 2334
59 Ga0207683_10076556 3300026121 Bacteria 2962
60 Ga0265338_10062580 3300028800 Bacteria 3251
61 Ga0307416_100058766 3300032002 Bacteria 3120
62 Ga0307416_100134217 3300032002 Bacteria 2235
63 Ga0307415_100012962 3300032126 Bacteria 4846
64 Ga0307415_100035977 3300032126 Unclassified 3240
65 Ga0373945_0002955 3300035116 Bacteria 5342
66 Ga0373943_0000316 3300035170 Bacteria 20268
67 Ga0373943_0001202 3300035170 Bacteria 11580
68 Ga0373935_0006057 3300035692 Bacteria 7188
69 Ga0373927_0091095 3300035695 Bacteria 1980
70 Ga0373947_0003003 3300035725 Bacteria 10061
71 Ga0373925_0021838 3300037068 Bacteria 4666
72 Ga0373925_0027537 3300037068 Bacteria 4159
73 Ga0395899_0050750 3300037312 Bacteria 3080
74 Ga0395900_0019117 3300037418 Bacteria 6986
75 Ga0395900_0020821 3300037418 Bacteria 6702
76 Ga0395900_0034332 3300037418 Bacteria 5222
77 Ga0395900_0079920 3300037418 Bacteria 3360
78 Ga0395900_0207786 3300037418 Bacteria 1978
79 Ga0395900_0269133 3300037418 Unclassified 1699
80 Ga0395898_0018451 3300037466 Bacteria 7114
81 Ga0395898_0042019 3300037466 Bacteria 4513
82 Ga0395898_0088288 3300037466 Bacteria 2985
83 Ga0395905_0034087 3300037471 Bacteria 4780
84 Ga0395905_0072576 3300037471 Bacteria 3227
85 Ga0395905_0082982 3300037471 Bacteria 3003
86 Ga0395905_0123331 3300037471 Bacteria 2436
87 Ga0395901_0009107 3300038443 Bacteria 10052
88 Ga0395901_0023074 3300038443 Bacteria 6377
89 Ga0395901_0038599 3300038443 Unclassified 4940
90 Ga0395901_0104203 3300038443 Bacteria 2977
91 Ga0395901_0145480 3300038443 Bacteria 2491
92 Ga0395901_0250516 3300038443 Unclassified 1845
93 Ga0466966_0041597 3300044684 Bacteria 2953
94 Ga0466961_0055723 3300044693 Bacteria 2519
95 Ga0466964_0003353 3300044706 Bacteria 5837
96 Ga0466964_0012983 3300044706 Bacteria 3155
97 Ga0466964_0016017 3300044706 Bacteria 2856
98 Ga0466970_0056311 3300044765 Unclassified 2101
99 Ga0466959_0033923 3300045049 Bacteria 3776
100 Ga0466959_0037603 3300045049 Bacteria 3577
101 Ga0451576_0030583 3300045051 Bacteria 5754
102 Ga0466958_0029361 3300045836 Bacteria 3263
103 Ga0466967_0012430 3300045976 Bacteria 6511
104 Ga0466967_0052207 3300045976 Bacteria 3587
105 Ga0466967_0083517 3300045976 Bacteria 2888
106 Ga0495603_0052234 3300046455 Bacteria 2427
107 Ga0495629_0001878 3300046459 Bacteria 16398
108 Ga0495629_0009307 3300046459 Bacteria 7188
109 Ga0495641_0000612 3300046461 Bacteria 30028
110 Ga0495651_0022804 3300046462 Bacteria 4867
111 Ga0495651_0024035 3300046462 Bacteria 4741
112 Ga0495651_0059810 3300046462 Bacteria 2920
113 Ga0495653_0087527 3300046463 Bacteria 2287
114 Ga0495639_0005929 3300046475 Bacteria 5259
115 Ga0495608_0014142 3300046511 Bacteria 5537
116 Ga0495628_0058990 3300046516 Bacteria 3015
117 Ga0495630_0168678 3300046517 Unclassified 1667
118 Ga0495652_0093165 3300046529 Bacteria 2460
119 Ga0495665_0004141 3300046531 Bacteria 7820
120 Ga0495640_0021781 3300046533 Bacteria 4695
121 Ga0495657_0047424 3300046675 Bacteria 2905
122 Ga0495657_0074182 3300046675 Bacteria 2214
123 Ga0495647_0002752 3300046681 Bacteria 5579
124 Ga0495658_0001191 3300046683 Bacteria 13704
125 Ga0495658_0009353 3300046683 Bacteria 4882
126 Ga0495613_0001533 3300046689 Bacteria 17578
127 Ga0495613_0016382 3300046689 Bacteria 5522
128 Ga0495624_0009456 3300046690 Bacteria 6753
129 Ga0495600_0027911 3300046809 Bacteria 3650
130 Ga0495581_0003707 3300047315 Bacteria 8803
131 Ga0495581_0011296 3300047315 Bacteria 5164
132 Ga0495604_0092503 3300047317 Bacteria 2240
133 Ga0495676_0119449 3300047321 Unclassified 1920
134 Ga0495680_0001345 3300047322 Bacteria 26708
135 Ga0495680_0008033 3300047322 Bacteria 9623
136 Ga0495684_0004375 3300047471 Bacteria 11040
137 Ga0495593_0001083 3300047673 Bacteria 15906
138 Ga0495614_0008875 3300048089 Bacteria 4461
139 Ga0496100_0048512 3300048903 Bacteria 2741
140 Ga0496100_0064108 3300048903 Bacteria 2430
141 Ga0496100_0087545 3300048903 Bacteria 2118
142 Ga0496101_0010449 3300048904 Bacteria 6131
143 Ga0496101_0022867 3300048904 Bacteria 4310
144 Ga0496102_0051597 3300048905 Bacteria 3747
145 Ga0496102_0068438 3300048905 Bacteria 3258
146 Ga0496102_0086089 3300048905 Bacteria 2902
147 Ga0496102_0101013 3300048905 Bacteria 2679
148 Ga0496103_0033195 3300048906 Bacteria 3153
149 Ga0496103_0041216 3300048906 Bacteria 2838
150 Ga0496103_0050356 3300048906 Bacteria 2576
151 Ga0496104_0052082 3300048907 Bacteria 3866
152 Ga0496106_0002754 3300048909 Bacteria 13019
153 Ga0496106_0006643 3300048909 Bacteria 8563
154 Ga0496106_0010946 3300048909 Bacteria 6706
155 Ga0496106_0019652 3300048909 Bacteria 5011
156 Ga0496106_0034557 3300048909 Bacteria 3777
157 Ga0496107_0001709 3300048910 Bacteria 13771
158 Ga0496107_0003770 3300048910 Bacteria 10178
159 Ga0496107_0005553 3300048910 Bacteria 8638
160 Ga0496107_0050711 3300048910 Bacteria 2992
161 Ga0496108_0166821 3300048911 Bacteria 1904
162 Ga0496109_0107879 3300048912 Bacteria 2587
163 Ga0496112_0025354 3300048915 Bacteria 5694
164 Ga0496112_0047011 3300048915 Bacteria 4233
165 Ga0496112_0076360 3300048915 Bacteria 3313
166 Ga0496112_0089927 3300048915 Bacteria 3039
167 Ga0496112_0093582 3300048915 Bacteria 2975
168 Ga0496114_0009031 3300048917 Bacteria 7902
169 Ga0496114_0062344 3300048917 Bacteria 3120
170 Ga0496114_0133758 3300048917 Unclassified 2143
171 Ga0496115_0001212 3300048918 Bacteria 18489
172 Ga0496115_0012509 3300048918 Bacteria 6390
173 Ga0496115_0027782 3300048918 Unclassified 4429
174 Ga0496115_0121025 3300048918 Bacteria 2154
175 Ga0501043_0073488 3300049579 Bacteria 2686
176 Ga0501046_0093442 3300049580 Bacteria 2312
177 Ga0501047_0081094 3300049581 Bacteria 3119
178 Ga0501047_0236301 3300049581 Bacteria 1679
179 Ga0501070_0111446 3300049586 Bacteria 2261
180 Ga0501074_0080273 3300049590 Bacteria 2341
181 Ga0501080_0114383 3300049742 Unclassified 2501
182 Ga0501044_0221047 3300049823 Bacteria 1845
183 nmdc:mga08y16_424404_c1 3300050511 Unclassified 1359
184 nmdc:mga08y16_93033_c1 3300050511 Bacteria 3141
185 nmdc:mga0n895_28682_c1 3300050512 Bacteria 5298
186 nmdc:mga0n895_72392_c1 3300050512 Bacteria 3419
187 nmdc:mga0rr50_36252_c1 3300050513 Bacteria 3550
188 nmdc:mga08x19_87284_c1 3300050514 Unclassified 2055
189 nmdc:mga0a205_33201_c1 3300050515 Bacteria 4948
190 Ga0495595_0001149 3300053084 Bacteria 10245
191 Ga0495619_0005106 3300053085 Bacteria 8336
192 Ga0495619_0062388 3300053085 Bacteria 2481
193 Ga0495619_0079451 3300053085 Bacteria 2206
194 Ga0587070_004992 3300059491 Unclassified 1714
195 Ga0587073_0005259 3300059492 Unclassified 1917
196 Ga0587077_004943 3300059493 Bacteria 1788
197 Ga0587082_004403 3300059504 Bacteria 1764
198 Ga0587082_004749 3300059504 Unclassified 1726
199 Ga0587083_0005787 3300059505 Unclassified 1807
200 Ga0587083_0006757 3300059505 Unclassified 1724
201 Ga0587088_003334 3300059508 Unclassified 1935
202 Ga0587117_001500 3300059627 Bacteria 1992
203 Ga0587069_003020 3300059642 Bacteria 1776
204 Ga0587075_003952 3300059644 Bacteria 1692
205 Ga0587107_002209 3300059652 Unclassified 1728
206 Ga0587071_007229 3300060344 Unclassified 1763
207 Ga0466962_0043032 3300061719 Bacteria 2162
208 Ga0495674_0046867
209 Ga0007417J51691_1029907
210 Ga0058861_10011057
211 Ga0058860_12082304
212 Ga0058862_10015162
213 Ga0058862_10108407
214 Ga0058862_10203476
215 Ga0070683_100004401
216 Ga0070683_100054286
217 Ga0068868_100121785
218 Ga0070660_100005605
219 Ga0070660_100020982
220 Ga0070671_100011266
221 Ga0070711_100116692
222 Ga0070694_100044136
223 Ga0070708_100013699
224 Ga0070678_100047542
225 Ga0070681_10008751
226 Ga0070681_10057530
227 Ga0070681_10064927
228 Ga0070679_100012133
229 Ga0070679_100067037
230 Ga0068855_100070933
231 Ga0081455_10019751
232 Ga0081455_10048534
233 Ga0097621_100086179
234 Ga0075434_100019104
235 Ga0075436_100056447
236 Ga0075436_100082660
237 Ga0111539_10285334
238 Ga0114129_10110849
239 Ga0105243_10087160
240 Ga0105243_10133145
241 Ga0105248_10046864
242 Ga0157369_10036561
243 Ga0157369_10220881
244 Ga0157372_10088692
245 Ga0157375_10085825
246 Ga0157376_10065019
247 Ga0224712_10031428
248 Ga0207707_10038235
249 Ga0207707_10039213
250 Ga0207707_10092114
251 Ga0207707_10116895
252 Ga0207657_10023823
253 Ga0207657_10048745
254 Ga0207652_10006523
255 Ga0207652_10189618
256 Ga0207700_10037893
257 Ga0207700_10175626
258 Ga0207686_10075647
259 Ga0207709_10056604
260 Ga0207709_10073105
261 Ga0207704_10110710
262 Ga0207661_10051393
263 Ga0207679_10089573
264 Ga0207667_10064584
265 Ga0207674_10144893
266 Ga0207683_10076556
267 Ga0265338_10062580
268 Ga0307416_100058766
269 Ga0307416_100134217
270 Ga0307415_100012962
271 Ga0307415_100035977
272 Ga0373945_0002955
273 Ga0373943_0000316
274 Ga0373943_0001202
275 Ga0373935_0006057
276 Ga0373927_0091095
277 Ga0373947_0003003
278 Ga0373925_0021838
279 Ga0373925_0027537
280 Ga0395899_0050750
281 Ga0395900_0019117
282 Ga0395900_0020821
283 Ga0395900_0034332
284 Ga0395900_0079920
285 Ga0395900_0207786
286 Ga0395900_0269133
287 Ga0395898_0018451
288 Ga0395898_0042019
289 Ga0395898_0088288
290 Ga0395905_0034087
291 Ga0395905_0072576
292 Ga0395905_0082982
293 Ga0395905_0123331
294 Ga0395901_0009107
295 Ga0395901_0023074
296 Ga0395901_0038599
297 Ga0395901_0104203
298 Ga0395901_0145480
299 Ga0395901_0250516
300 Ga0466966_0041597
301 Ga0466961_0055723
302 Ga0466964_0003353
303 Ga0466964_0012983
304 Ga0466964_0016017
305 Ga0466970_0056311
306 Ga0466959_0033923
307 Ga0466959_0037603
308 Ga0451576_0030583
309 Ga0466958_0029361
310 Ga0466967_0012430
311 Ga0466967_0052207
312 Ga0466967_0083517
313 Ga0495603_0052234
314 Ga0495629_0001878
315 Ga0495629_0009307
316 Ga0495641_0000612
317 Ga0495651_0022804
318 Ga0495651_0024035
319 Ga0495651_0059810
320 Ga0495653_0087527
321 Ga0495639_0005929
322 Ga0495608_0014142
323 Ga0495628_0058990
324 Ga0495630_0168678
325 Ga0495652_0093165
326 Ga0495665_0004141
327 Ga0495640_0021781
328 Ga0495657_0047424
329 Ga0495657_0074182
330 Ga0495647_0002752
331 Ga0495658_0001191
332 Ga0495658_0009353
333 Ga0495613_0001533
334 Ga0495613_0016382
335 Ga0495624_0009456
336 Ga0495600_0027911
337 Ga0495581_0003707
338 Ga0495581_0011296
339 Ga0495604_0092503
340 Ga0495676_0119449
341 Ga0495680_0001345
342 Ga0495680_0008033
343 Ga0495684_0004375
344 Ga0495593_0001083
345 Ga0495614_0008875
346 Ga0496100_0048512
347 Ga0496100_0064108
348 Ga0496100_0087545
349 Ga0496101_0010449
350 Ga0496101_0022867
351 Ga0496102_0051597
352 Ga0496102_0068438
353 Ga0496102_0086089
354 Ga0496102_0101013
355 Ga0496103_0033195
356 Ga0496103_0041216
357 Ga0496103_0050356
358 Ga0496104_0052082
359 Ga0496106_0002754
360 Ga0496106_0006643
361 Ga0496106_0010946
362 Ga0496106_0019652
363 Ga0496106_0034557
364 Ga0496107_0001709
365 Ga0496107_0003770
366 Ga0496107_0005553
367 Ga0496107_0050711
368 Ga0496108_0166821
369 Ga0496109_0107879
370 Ga0496112_0025354
371 Ga0496112_0047011
372 Ga0496112_0076360
373 Ga0496112_0089927
374 Ga0496112_0093582
375 Ga0496114_0009031
376 Ga0496114_0062344
377 Ga0496114_0133758
378 Ga0496115_0001212
379 Ga0496115_0012509
380 Ga0496115_0027782
381 Ga0496115_0121025
382 Ga0501043_0073488
383 Ga0501046_0093442
384 Ga0501047_0081094
385 Ga0501047_0236301
386 Ga0501070_0111446
387 Ga0501074_0080273
388 Ga0501080_0114383
389 Ga0501044_0221047
390 nmdc:mga08y16_424404_c1
391 nmdc:mga08y16_93033_c1
392 nmdc:mga0n895_28682_c1
393 nmdc:mga0n895_72392_c1
394 nmdc:mga0rr50_36252_c1
395 nmdc:mga08x19_87284_c1
396 nmdc:mga0a205_33201_c1
397 Ga0495595_0001149
398 Ga0495619_0005106
399 Ga0495619_0062388
400 Ga0495619_0079451
401 Ga0587070_004992
402 Ga0587073_0005259
403 Ga0587077_004943
404 Ga0587082_004403
405 Ga0587082_004749
406 Ga0587083_0005787
407 Ga0587083_0006757
408 Ga0587088_003334
409 Ga0587117_001500
410 Ga0587069_003020
411 Ga0587075_003952
412 Ga0587107_002209
413 Ga0587071_007229
414 Ga0466962_0043032

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

116

486

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o98-assembly1.cif.gz_A glutathionylspermidine synthetase/amidase c59a complex with adp and gsp 0.888 366 401
8upi-assembly1.cif.gz_A structure of a periplasmic peptide binding protein from mesorhizobium sp. ap09 bound to aminoserine 0.8628 26 528
8arn-assembly2.cif.gz_B crystal structure of the peptide binding protein, oppa, from bacillus subtilis in complex with an endogenous tetrapeptide 0.8598 29 528
6hlx-assembly1.cif.gz_A structure of the pbp agaa in complex with agropinic acid from a.tumefacien r10 0.8524 28 528
8upi-assembly1.cif.gz_A structure of a periplasmic peptide binding protein from mesorhizobium sp. ap09 bound to aminoserine 0.8499 26 528
ID Description Score Start End Superfamily
6hlxA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.9002 37 183 3.90.76.10
1uqwB02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.885 37 179 3.90.76.10
af_P76128_42_177_3.90.76.10 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8691 42 182 3.90.76.10
af_Q2FVE7_35_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.848 30 251 3.40.190.10
af_P75797_27_224_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8451 29 235 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A7W0P9T8-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9469 25 238 GO:0015031
GO:0015833
GO:0030313
GO:1904680
AF-A0A537NQJ7-F1-model_v4 ABC transporter substrate-binding protein 0.9292 25 261 GO:0015031
GO:0015833
GO:0030313
GO:1904680
AF-A0A538LCE5-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9216 34 207 GO:0015833
GO:1904680
AF-A0A7V9C1H1-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.911 185 528 GO:0015031
GO:0015833
GO:0030313
GO:1904680
AF-A0A0S8KCM5-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9067 19 528 GO:0015833
GO:0042597
GO:0043190
GO:1904680

Map