F316931
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 207 | 126 | 414 | 521 |
Family's Representative Sequence
| Representative Sequence | 3300047319|Ga0495674_0046867|Ga0495674_0046867_1645_3351 |
| Length | 568 |
| Sequence | VSRPFRINHASIRTFHRPTPLTAKANVRRAPSAERKGRMRSTIGAALIVLLTALVVAGTAGAKQVKTGGTLNVDLATDVDYTDPSLSYLSTGWELEYATCLKLVNYPDANGPRASQLVPEASSGFPKVSKDGKTYDFTVAAGFTKFSNGQPVTAASFKAALDRDADPKMQSPSGAFMSDIVGANTSPVSGVRVKGNHLLITMTHAAPDLLARLAMPFFCAVPASLPHDPNGVDTPPSAGPYYVSSRVANRSIVLKRNPYYKGKRPHNANQIDYTVGNSLDATYLRVQQGATDYAAGGIPPASYAEAAQKYGINKGQFWVKPLLNTSYLAFNTSRGVFKNNIALRKAVNQVIDRRAMLSQSGFLAGKRTDQILPPGIAGFRDADLYPLQQPNIKAAQKLAKGHTGDGNVVLYEGNRGASPLRAQIVQFNLKQIGLDVNITLLPRAVQIQKEGTRGEPFDIADESWGADYADPYDFINVLLDGKNIQDSNNNNFSYFNDPKFNAQMTQASLLSGNPRYTAYGNLDVAIMQQAVPWAPRANANNRMLVSKRFGCFTYSAIYTVDLAAACLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 20 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 21 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 30 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 43 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 44 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 45 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 46 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 47 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 48 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 49 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 50 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 51 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 52 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 53 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 54 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 55 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 56 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 57 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 58 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 59 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 60 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 61 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 62 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 63 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 64 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 92 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 93 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 94 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 95 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 96 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 99 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 100 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 101 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.34 |
| Metatranscriptomes | 9.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 17.39 |
| Rhizosphere | 82.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495674_0046867 | 3300047319 | Bacteria | 3835 |
| 2 | Ga0007417J51691_1029907 | 3300003544 | Bacteria | 1667 |
| 3 | Ga0058861_10011057 | 3300004800 | Bacteria | 1716 |
| 4 | Ga0058860_12082304 | 3300004801 | Unclassified | 1983 |
| 5 | Ga0058862_10015162 | 3300004803 | Bacteria | 1962 |
| 6 | Ga0058862_10108407 | 3300004803 | Bacteria | 1782 |
| 7 | Ga0058862_10203476 | 3300004803 | Unclassified | 1773 |
| 8 | Ga0070683_100004401 | 3300005329 | Bacteria | 11600 |
| 9 | Ga0070683_100054286 | 3300005329 | Bacteria | 3715 |
| 10 | Ga0068868_100121785 | 3300005338 | Bacteria | 2128 |
| 11 | Ga0070660_100005605 | 3300005339 | Bacteria | 8703 |
| 12 | Ga0070660_100020982 | 3300005339 | Bacteria | 4810 |
| 13 | Ga0070671_100011266 | 3300005355 | Bacteria | 7184 |
| 14 | Ga0070711_100116692 | 3300005439 | Unclassified | 1967 |
| 15 | Ga0070694_100044136 | 3300005444 | Bacteria | 2983 |
| 16 | Ga0070708_100013699 | 3300005445 | Bacteria | 6652 |
| 17 | Ga0070678_100047542 | 3300005456 | Bacteria | 3084 |
| 18 | Ga0070681_10008751 | 3300005458 | Bacteria | 9932 |
| 19 | Ga0070681_10057530 | 3300005458 | Bacteria | 3868 |
| 20 | Ga0070681_10064927 | 3300005458 | Bacteria | 3620 |
| 21 | Ga0070679_100012133 | 3300005530 | Bacteria | 8233 |
| 22 | Ga0070679_100067037 | 3300005530 | Bacteria | 3579 |
| 23 | Ga0068855_100070933 | 3300005563 | Bacteria | 4052 |
| 24 | Ga0081455_10019751 | 3300005937 | Bacteria | 6365 |
| 25 | Ga0081455_10048534 | 3300005937 | Bacteria | 3667 |
| 26 | Ga0097621_100086179 | 3300006237 | Bacteria | 2621 |
| 27 | Ga0075434_100019104 | 3300006871 | Bacteria | 6624 |
| 28 | Ga0075436_100056447 | 3300006914 | Bacteria | 2712 |
| 29 | Ga0075436_100082660 | 3300006914 | Unclassified | 2228 |
| 30 | Ga0111539_10285334 | 3300009094 | Bacteria | 1921 |
| 31 | Ga0114129_10110849 | 3300009147 | Bacteria | 3788 |
| 32 | Ga0105243_10087160 | 3300009148 | Unclassified | 2562 |
| 33 | Ga0105243_10133145 | 3300009148 | Unclassified | 2112 |
| 34 | Ga0105248_10046864 | 3300009177 | Bacteria | 4847 |
| 35 | Ga0157369_10036561 | 3300013105 | Bacteria | 5379 |
| 36 | Ga0157369_10220881 | 3300013105 | Unclassified | 1984 |
| 37 | Ga0157372_10088692 | 3300013307 | Bacteria | 3512 |
| 38 | Ga0157375_10085825 | 3300013308 | Bacteria | 3198 |
| 39 | Ga0157376_10065019 | 3300014969 | Bacteria | 3078 |
| 40 | Ga0224712_10031428 | 3300022467 | Bacteria | 1926 |
| 41 | Ga0207707_10038235 | 3300025912 | Bacteria | 4194 |
| 42 | Ga0207707_10039213 | 3300025912 | Bacteria | 4141 |
| 43 | Ga0207707_10092114 | 3300025912 | Bacteria | 2649 |
| 44 | Ga0207707_10116895 | 3300025912 | Bacteria | 2331 |
| 45 | Ga0207657_10023823 | 3300025919 | Bacteria | 5689 |
| 46 | Ga0207657_10048745 | 3300025919 | Bacteria | 3697 |
| 47 | Ga0207652_10006523 | 3300025921 | Bacteria | 9407 |
| 48 | Ga0207652_10189618 | 3300025921 | Bacteria | 1849 |
| 49 | Ga0207700_10037893 | 3300025928 | Bacteria | 3496 |
| 50 | Ga0207700_10175626 | 3300025928 | Unclassified | 1790 |
| 51 | Ga0207686_10075647 | 3300025934 | Unclassified | 2180 |
| 52 | Ga0207709_10056604 | 3300025935 | Unclassified | 2427 |
| 53 | Ga0207709_10073105 | 3300025935 | Unclassified | 2183 |
| 54 | Ga0207704_10110710 | 3300025938 | Bacteria | 1855 |
| 55 | Ga0207661_10051393 | 3300025944 | Bacteria | 3289 |
| 56 | Ga0207679_10089573 | 3300025945 | Unclassified | 2375 |
| 57 | Ga0207667_10064584 | 3300025949 | Bacteria | 3820 |
| 58 | Ga0207674_10144893 | 3300026116 | Bacteria | 2334 |
| 59 | Ga0207683_10076556 | 3300026121 | Bacteria | 2962 |
| 60 | Ga0265338_10062580 | 3300028800 | Bacteria | 3251 |
| 61 | Ga0307416_100058766 | 3300032002 | Bacteria | 3120 |
| 62 | Ga0307416_100134217 | 3300032002 | Bacteria | 2235 |
| 63 | Ga0307415_100012962 | 3300032126 | Bacteria | 4846 |
| 64 | Ga0307415_100035977 | 3300032126 | Unclassified | 3240 |
| 65 | Ga0373945_0002955 | 3300035116 | Bacteria | 5342 |
| 66 | Ga0373943_0000316 | 3300035170 | Bacteria | 20268 |
| 67 | Ga0373943_0001202 | 3300035170 | Bacteria | 11580 |
| 68 | Ga0373935_0006057 | 3300035692 | Bacteria | 7188 |
| 69 | Ga0373927_0091095 | 3300035695 | Bacteria | 1980 |
| 70 | Ga0373947_0003003 | 3300035725 | Bacteria | 10061 |
| 71 | Ga0373925_0021838 | 3300037068 | Bacteria | 4666 |
| 72 | Ga0373925_0027537 | 3300037068 | Bacteria | 4159 |
| 73 | Ga0395899_0050750 | 3300037312 | Bacteria | 3080 |
| 74 | Ga0395900_0019117 | 3300037418 | Bacteria | 6986 |
| 75 | Ga0395900_0020821 | 3300037418 | Bacteria | 6702 |
| 76 | Ga0395900_0034332 | 3300037418 | Bacteria | 5222 |
| 77 | Ga0395900_0079920 | 3300037418 | Bacteria | 3360 |
| 78 | Ga0395900_0207786 | 3300037418 | Bacteria | 1978 |
| 79 | Ga0395900_0269133 | 3300037418 | Unclassified | 1699 |
| 80 | Ga0395898_0018451 | 3300037466 | Bacteria | 7114 |
| 81 | Ga0395898_0042019 | 3300037466 | Bacteria | 4513 |
| 82 | Ga0395898_0088288 | 3300037466 | Bacteria | 2985 |
| 83 | Ga0395905_0034087 | 3300037471 | Bacteria | 4780 |
| 84 | Ga0395905_0072576 | 3300037471 | Bacteria | 3227 |
| 85 | Ga0395905_0082982 | 3300037471 | Bacteria | 3003 |
| 86 | Ga0395905_0123331 | 3300037471 | Bacteria | 2436 |
| 87 | Ga0395901_0009107 | 3300038443 | Bacteria | 10052 |
| 88 | Ga0395901_0023074 | 3300038443 | Bacteria | 6377 |
| 89 | Ga0395901_0038599 | 3300038443 | Unclassified | 4940 |
| 90 | Ga0395901_0104203 | 3300038443 | Bacteria | 2977 |
| 91 | Ga0395901_0145480 | 3300038443 | Bacteria | 2491 |
| 92 | Ga0395901_0250516 | 3300038443 | Unclassified | 1845 |
| 93 | Ga0466966_0041597 | 3300044684 | Bacteria | 2953 |
| 94 | Ga0466961_0055723 | 3300044693 | Bacteria | 2519 |
| 95 | Ga0466964_0003353 | 3300044706 | Bacteria | 5837 |
| 96 | Ga0466964_0012983 | 3300044706 | Bacteria | 3155 |
| 97 | Ga0466964_0016017 | 3300044706 | Bacteria | 2856 |
| 98 | Ga0466970_0056311 | 3300044765 | Unclassified | 2101 |
| 99 | Ga0466959_0033923 | 3300045049 | Bacteria | 3776 |
| 100 | Ga0466959_0037603 | 3300045049 | Bacteria | 3577 |
| 101 | Ga0451576_0030583 | 3300045051 | Bacteria | 5754 |
| 102 | Ga0466958_0029361 | 3300045836 | Bacteria | 3263 |
| 103 | Ga0466967_0012430 | 3300045976 | Bacteria | 6511 |
| 104 | Ga0466967_0052207 | 3300045976 | Bacteria | 3587 |
| 105 | Ga0466967_0083517 | 3300045976 | Bacteria | 2888 |
| 106 | Ga0495603_0052234 | 3300046455 | Bacteria | 2427 |
| 107 | Ga0495629_0001878 | 3300046459 | Bacteria | 16398 |
| 108 | Ga0495629_0009307 | 3300046459 | Bacteria | 7188 |
| 109 | Ga0495641_0000612 | 3300046461 | Bacteria | 30028 |
| 110 | Ga0495651_0022804 | 3300046462 | Bacteria | 4867 |
| 111 | Ga0495651_0024035 | 3300046462 | Bacteria | 4741 |
| 112 | Ga0495651_0059810 | 3300046462 | Bacteria | 2920 |
| 113 | Ga0495653_0087527 | 3300046463 | Bacteria | 2287 |
| 114 | Ga0495639_0005929 | 3300046475 | Bacteria | 5259 |
| 115 | Ga0495608_0014142 | 3300046511 | Bacteria | 5537 |
| 116 | Ga0495628_0058990 | 3300046516 | Bacteria | 3015 |
| 117 | Ga0495630_0168678 | 3300046517 | Unclassified | 1667 |
| 118 | Ga0495652_0093165 | 3300046529 | Bacteria | 2460 |
| 119 | Ga0495665_0004141 | 3300046531 | Bacteria | 7820 |
| 120 | Ga0495640_0021781 | 3300046533 | Bacteria | 4695 |
| 121 | Ga0495657_0047424 | 3300046675 | Bacteria | 2905 |
| 122 | Ga0495657_0074182 | 3300046675 | Bacteria | 2214 |
| 123 | Ga0495647_0002752 | 3300046681 | Bacteria | 5579 |
| 124 | Ga0495658_0001191 | 3300046683 | Bacteria | 13704 |
| 125 | Ga0495658_0009353 | 3300046683 | Bacteria | 4882 |
| 126 | Ga0495613_0001533 | 3300046689 | Bacteria | 17578 |
| 127 | Ga0495613_0016382 | 3300046689 | Bacteria | 5522 |
| 128 | Ga0495624_0009456 | 3300046690 | Bacteria | 6753 |
| 129 | Ga0495600_0027911 | 3300046809 | Bacteria | 3650 |
| 130 | Ga0495581_0003707 | 3300047315 | Bacteria | 8803 |
| 131 | Ga0495581_0011296 | 3300047315 | Bacteria | 5164 |
| 132 | Ga0495604_0092503 | 3300047317 | Bacteria | 2240 |
| 133 | Ga0495676_0119449 | 3300047321 | Unclassified | 1920 |
| 134 | Ga0495680_0001345 | 3300047322 | Bacteria | 26708 |
| 135 | Ga0495680_0008033 | 3300047322 | Bacteria | 9623 |
| 136 | Ga0495684_0004375 | 3300047471 | Bacteria | 11040 |
| 137 | Ga0495593_0001083 | 3300047673 | Bacteria | 15906 |
| 138 | Ga0495614_0008875 | 3300048089 | Bacteria | 4461 |
| 139 | Ga0496100_0048512 | 3300048903 | Bacteria | 2741 |
| 140 | Ga0496100_0064108 | 3300048903 | Bacteria | 2430 |
| 141 | Ga0496100_0087545 | 3300048903 | Bacteria | 2118 |
| 142 | Ga0496101_0010449 | 3300048904 | Bacteria | 6131 |
| 143 | Ga0496101_0022867 | 3300048904 | Bacteria | 4310 |
| 144 | Ga0496102_0051597 | 3300048905 | Bacteria | 3747 |
| 145 | Ga0496102_0068438 | 3300048905 | Bacteria | 3258 |
| 146 | Ga0496102_0086089 | 3300048905 | Bacteria | 2902 |
| 147 | Ga0496102_0101013 | 3300048905 | Bacteria | 2679 |
| 148 | Ga0496103_0033195 | 3300048906 | Bacteria | 3153 |
| 149 | Ga0496103_0041216 | 3300048906 | Bacteria | 2838 |
| 150 | Ga0496103_0050356 | 3300048906 | Bacteria | 2576 |
| 151 | Ga0496104_0052082 | 3300048907 | Bacteria | 3866 |
| 152 | Ga0496106_0002754 | 3300048909 | Bacteria | 13019 |
| 153 | Ga0496106_0006643 | 3300048909 | Bacteria | 8563 |
| 154 | Ga0496106_0010946 | 3300048909 | Bacteria | 6706 |
| 155 | Ga0496106_0019652 | 3300048909 | Bacteria | 5011 |
| 156 | Ga0496106_0034557 | 3300048909 | Bacteria | 3777 |
| 157 | Ga0496107_0001709 | 3300048910 | Bacteria | 13771 |
| 158 | Ga0496107_0003770 | 3300048910 | Bacteria | 10178 |
| 159 | Ga0496107_0005553 | 3300048910 | Bacteria | 8638 |
| 160 | Ga0496107_0050711 | 3300048910 | Bacteria | 2992 |
| 161 | Ga0496108_0166821 | 3300048911 | Bacteria | 1904 |
| 162 | Ga0496109_0107879 | 3300048912 | Bacteria | 2587 |
| 163 | Ga0496112_0025354 | 3300048915 | Bacteria | 5694 |
| 164 | Ga0496112_0047011 | 3300048915 | Bacteria | 4233 |
| 165 | Ga0496112_0076360 | 3300048915 | Bacteria | 3313 |
| 166 | Ga0496112_0089927 | 3300048915 | Bacteria | 3039 |
| 167 | Ga0496112_0093582 | 3300048915 | Bacteria | 2975 |
| 168 | Ga0496114_0009031 | 3300048917 | Bacteria | 7902 |
| 169 | Ga0496114_0062344 | 3300048917 | Bacteria | 3120 |
| 170 | Ga0496114_0133758 | 3300048917 | Unclassified | 2143 |
| 171 | Ga0496115_0001212 | 3300048918 | Bacteria | 18489 |
| 172 | Ga0496115_0012509 | 3300048918 | Bacteria | 6390 |
| 173 | Ga0496115_0027782 | 3300048918 | Unclassified | 4429 |
| 174 | Ga0496115_0121025 | 3300048918 | Bacteria | 2154 |
| 175 | Ga0501043_0073488 | 3300049579 | Bacteria | 2686 |
| 176 | Ga0501046_0093442 | 3300049580 | Bacteria | 2312 |
| 177 | Ga0501047_0081094 | 3300049581 | Bacteria | 3119 |
| 178 | Ga0501047_0236301 | 3300049581 | Bacteria | 1679 |
| 179 | Ga0501070_0111446 | 3300049586 | Bacteria | 2261 |
| 180 | Ga0501074_0080273 | 3300049590 | Bacteria | 2341 |
| 181 | Ga0501080_0114383 | 3300049742 | Unclassified | 2501 |
| 182 | Ga0501044_0221047 | 3300049823 | Bacteria | 1845 |
| 183 | nmdc:mga08y16_424404_c1 | 3300050511 | Unclassified | 1359 |
| 184 | nmdc:mga08y16_93033_c1 | 3300050511 | Bacteria | 3141 |
| 185 | nmdc:mga0n895_28682_c1 | 3300050512 | Bacteria | 5298 |
| 186 | nmdc:mga0n895_72392_c1 | 3300050512 | Bacteria | 3419 |
| 187 | nmdc:mga0rr50_36252_c1 | 3300050513 | Bacteria | 3550 |
| 188 | nmdc:mga08x19_87284_c1 | 3300050514 | Unclassified | 2055 |
| 189 | nmdc:mga0a205_33201_c1 | 3300050515 | Bacteria | 4948 |
| 190 | Ga0495595_0001149 | 3300053084 | Bacteria | 10245 |
| 191 | Ga0495619_0005106 | 3300053085 | Bacteria | 8336 |
| 192 | Ga0495619_0062388 | 3300053085 | Bacteria | 2481 |
| 193 | Ga0495619_0079451 | 3300053085 | Bacteria | 2206 |
| 194 | Ga0587070_004992 | 3300059491 | Unclassified | 1714 |
| 195 | Ga0587073_0005259 | 3300059492 | Unclassified | 1917 |
| 196 | Ga0587077_004943 | 3300059493 | Bacteria | 1788 |
| 197 | Ga0587082_004403 | 3300059504 | Bacteria | 1764 |
| 198 | Ga0587082_004749 | 3300059504 | Unclassified | 1726 |
| 199 | Ga0587083_0005787 | 3300059505 | Unclassified | 1807 |
| 200 | Ga0587083_0006757 | 3300059505 | Unclassified | 1724 |
| 201 | Ga0587088_003334 | 3300059508 | Unclassified | 1935 |
| 202 | Ga0587117_001500 | 3300059627 | Bacteria | 1992 |
| 203 | Ga0587069_003020 | 3300059642 | Bacteria | 1776 |
| 204 | Ga0587075_003952 | 3300059644 | Bacteria | 1692 |
| 205 | Ga0587107_002209 | 3300059652 | Unclassified | 1728 |
| 206 | Ga0587071_007229 | 3300060344 | Unclassified | 1763 |
| 207 | Ga0466962_0043032 | 3300061719 | Bacteria | 2162 |
| 208 | Ga0495674_0046867 | |||
| 209 | Ga0007417J51691_1029907 | |||
| 210 | Ga0058861_10011057 | |||
| 211 | Ga0058860_12082304 | |||
| 212 | Ga0058862_10015162 | |||
| 213 | Ga0058862_10108407 | |||
| 214 | Ga0058862_10203476 | |||
| 215 | Ga0070683_100004401 | |||
| 216 | Ga0070683_100054286 | |||
| 217 | Ga0068868_100121785 | |||
| 218 | Ga0070660_100005605 | |||
| 219 | Ga0070660_100020982 | |||
| 220 | Ga0070671_100011266 | |||
| 221 | Ga0070711_100116692 | |||
| 222 | Ga0070694_100044136 | |||
| 223 | Ga0070708_100013699 | |||
| 224 | Ga0070678_100047542 | |||
| 225 | Ga0070681_10008751 | |||
| 226 | Ga0070681_10057530 | |||
| 227 | Ga0070681_10064927 | |||
| 228 | Ga0070679_100012133 | |||
| 229 | Ga0070679_100067037 | |||
| 230 | Ga0068855_100070933 | |||
| 231 | Ga0081455_10019751 | |||
| 232 | Ga0081455_10048534 | |||
| 233 | Ga0097621_100086179 | |||
| 234 | Ga0075434_100019104 | |||
| 235 | Ga0075436_100056447 | |||
| 236 | Ga0075436_100082660 | |||
| 237 | Ga0111539_10285334 | |||
| 238 | Ga0114129_10110849 | |||
| 239 | Ga0105243_10087160 | |||
| 240 | Ga0105243_10133145 | |||
| 241 | Ga0105248_10046864 | |||
| 242 | Ga0157369_10036561 | |||
| 243 | Ga0157369_10220881 | |||
| 244 | Ga0157372_10088692 | |||
| 245 | Ga0157375_10085825 | |||
| 246 | Ga0157376_10065019 | |||
| 247 | Ga0224712_10031428 | |||
| 248 | Ga0207707_10038235 | |||
| 249 | Ga0207707_10039213 | |||
| 250 | Ga0207707_10092114 | |||
| 251 | Ga0207707_10116895 | |||
| 252 | Ga0207657_10023823 | |||
| 253 | Ga0207657_10048745 | |||
| 254 | Ga0207652_10006523 | |||
| 255 | Ga0207652_10189618 | |||
| 256 | Ga0207700_10037893 | |||
| 257 | Ga0207700_10175626 | |||
| 258 | Ga0207686_10075647 | |||
| 259 | Ga0207709_10056604 | |||
| 260 | Ga0207709_10073105 | |||
| 261 | Ga0207704_10110710 | |||
| 262 | Ga0207661_10051393 | |||
| 263 | Ga0207679_10089573 | |||
| 264 | Ga0207667_10064584 | |||
| 265 | Ga0207674_10144893 | |||
| 266 | Ga0207683_10076556 | |||
| 267 | Ga0265338_10062580 | |||
| 268 | Ga0307416_100058766 | |||
| 269 | Ga0307416_100134217 | |||
| 270 | Ga0307415_100012962 | |||
| 271 | Ga0307415_100035977 | |||
| 272 | Ga0373945_0002955 | |||
| 273 | Ga0373943_0000316 | |||
| 274 | Ga0373943_0001202 | |||
| 275 | Ga0373935_0006057 | |||
| 276 | Ga0373927_0091095 | |||
| 277 | Ga0373947_0003003 | |||
| 278 | Ga0373925_0021838 | |||
| 279 | Ga0373925_0027537 | |||
| 280 | Ga0395899_0050750 | |||
| 281 | Ga0395900_0019117 | |||
| 282 | Ga0395900_0020821 | |||
| 283 | Ga0395900_0034332 | |||
| 284 | Ga0395900_0079920 | |||
| 285 | Ga0395900_0207786 | |||
| 286 | Ga0395900_0269133 | |||
| 287 | Ga0395898_0018451 | |||
| 288 | Ga0395898_0042019 | |||
| 289 | Ga0395898_0088288 | |||
| 290 | Ga0395905_0034087 | |||
| 291 | Ga0395905_0072576 | |||
| 292 | Ga0395905_0082982 | |||
| 293 | Ga0395905_0123331 | |||
| 294 | Ga0395901_0009107 | |||
| 295 | Ga0395901_0023074 | |||
| 296 | Ga0395901_0038599 | |||
| 297 | Ga0395901_0104203 | |||
| 298 | Ga0395901_0145480 | |||
| 299 | Ga0395901_0250516 | |||
| 300 | Ga0466966_0041597 | |||
| 301 | Ga0466961_0055723 | |||
| 302 | Ga0466964_0003353 | |||
| 303 | Ga0466964_0012983 | |||
| 304 | Ga0466964_0016017 | |||
| 305 | Ga0466970_0056311 | |||
| 306 | Ga0466959_0033923 | |||
| 307 | Ga0466959_0037603 | |||
| 308 | Ga0451576_0030583 | |||
| 309 | Ga0466958_0029361 | |||
| 310 | Ga0466967_0012430 | |||
| 311 | Ga0466967_0052207 | |||
| 312 | Ga0466967_0083517 | |||
| 313 | Ga0495603_0052234 | |||
| 314 | Ga0495629_0001878 | |||
| 315 | Ga0495629_0009307 | |||
| 316 | Ga0495641_0000612 | |||
| 317 | Ga0495651_0022804 | |||
| 318 | Ga0495651_0024035 | |||
| 319 | Ga0495651_0059810 | |||
| 320 | Ga0495653_0087527 | |||
| 321 | Ga0495639_0005929 | |||
| 322 | Ga0495608_0014142 | |||
| 323 | Ga0495628_0058990 | |||
| 324 | Ga0495630_0168678 | |||
| 325 | Ga0495652_0093165 | |||
| 326 | Ga0495665_0004141 | |||
| 327 | Ga0495640_0021781 | |||
| 328 | Ga0495657_0047424 | |||
| 329 | Ga0495657_0074182 | |||
| 330 | Ga0495647_0002752 | |||
| 331 | Ga0495658_0001191 | |||
| 332 | Ga0495658_0009353 | |||
| 333 | Ga0495613_0001533 | |||
| 334 | Ga0495613_0016382 | |||
| 335 | Ga0495624_0009456 | |||
| 336 | Ga0495600_0027911 | |||
| 337 | Ga0495581_0003707 | |||
| 338 | Ga0495581_0011296 | |||
| 339 | Ga0495604_0092503 | |||
| 340 | Ga0495676_0119449 | |||
| 341 | Ga0495680_0001345 | |||
| 342 | Ga0495680_0008033 | |||
| 343 | Ga0495684_0004375 | |||
| 344 | Ga0495593_0001083 | |||
| 345 | Ga0495614_0008875 | |||
| 346 | Ga0496100_0048512 | |||
| 347 | Ga0496100_0064108 | |||
| 348 | Ga0496100_0087545 | |||
| 349 | Ga0496101_0010449 | |||
| 350 | Ga0496101_0022867 | |||
| 351 | Ga0496102_0051597 | |||
| 352 | Ga0496102_0068438 | |||
| 353 | Ga0496102_0086089 | |||
| 354 | Ga0496102_0101013 | |||
| 355 | Ga0496103_0033195 | |||
| 356 | Ga0496103_0041216 | |||
| 357 | Ga0496103_0050356 | |||
| 358 | Ga0496104_0052082 | |||
| 359 | Ga0496106_0002754 | |||
| 360 | Ga0496106_0006643 | |||
| 361 | Ga0496106_0010946 | |||
| 362 | Ga0496106_0019652 | |||
| 363 | Ga0496106_0034557 | |||
| 364 | Ga0496107_0001709 | |||
| 365 | Ga0496107_0003770 | |||
| 366 | Ga0496107_0005553 | |||
| 367 | Ga0496107_0050711 | |||
| 368 | Ga0496108_0166821 | |||
| 369 | Ga0496109_0107879 | |||
| 370 | Ga0496112_0025354 | |||
| 371 | Ga0496112_0047011 | |||
| 372 | Ga0496112_0076360 | |||
| 373 | Ga0496112_0089927 | |||
| 374 | Ga0496112_0093582 | |||
| 375 | Ga0496114_0009031 | |||
| 376 | Ga0496114_0062344 | |||
| 377 | Ga0496114_0133758 | |||
| 378 | Ga0496115_0001212 | |||
| 379 | Ga0496115_0012509 | |||
| 380 | Ga0496115_0027782 | |||
| 381 | Ga0496115_0121025 | |||
| 382 | Ga0501043_0073488 | |||
| 383 | Ga0501046_0093442 | |||
| 384 | Ga0501047_0081094 | |||
| 385 | Ga0501047_0236301 | |||
| 386 | Ga0501070_0111446 | |||
| 387 | Ga0501074_0080273 | |||
| 388 | Ga0501080_0114383 | |||
| 389 | Ga0501044_0221047 | |||
| 390 | nmdc:mga08y16_424404_c1 | |||
| 391 | nmdc:mga08y16_93033_c1 | |||
| 392 | nmdc:mga0n895_28682_c1 | |||
| 393 | nmdc:mga0n895_72392_c1 | |||
| 394 | nmdc:mga0rr50_36252_c1 | |||
| 395 | nmdc:mga08x19_87284_c1 | |||
| 396 | nmdc:mga0a205_33201_c1 | |||
| 397 | Ga0495595_0001149 | |||
| 398 | Ga0495619_0005106 | |||
| 399 | Ga0495619_0062388 | |||
| 400 | Ga0495619_0079451 | |||
| 401 | Ga0587070_004992 | |||
| 402 | Ga0587073_0005259 | |||
| 403 | Ga0587077_004943 | |||
| 404 | Ga0587082_004403 | |||
| 405 | Ga0587082_004749 | |||
| 406 | Ga0587083_0005787 | |||
| 407 | Ga0587083_0006757 | |||
| 408 | Ga0587088_003334 | |||
| 409 | Ga0587117_001500 | |||
| 410 | Ga0587069_003020 | |||
| 411 | Ga0587075_003952 | |||
| 412 | Ga0587107_002209 | |||
| 413 | Ga0587071_007229 | |||
| 414 | Ga0466962_0043032 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o98-assembly1.cif.gz_A | glutathionylspermidine synthetase/amidase c59a complex with adp and gsp | 0.888 | 366 | 401 |
| 8upi-assembly1.cif.gz_A | structure of a periplasmic peptide binding protein from mesorhizobium sp. ap09 bound to aminoserine | 0.8628 | 26 | 528 |
| 8arn-assembly2.cif.gz_B | crystal structure of the peptide binding protein, oppa, from bacillus subtilis in complex with an endogenous tetrapeptide | 0.8598 | 29 | 528 |
| 6hlx-assembly1.cif.gz_A | structure of the pbp agaa in complex with agropinic acid from a.tumefacien r10 | 0.8524 | 28 | 528 |
| 8upi-assembly1.cif.gz_A | structure of a periplasmic peptide binding protein from mesorhizobium sp. ap09 bound to aminoserine | 0.8499 | 26 | 528 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hlxA02 | Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 | 0.9002 | 37 | 183 | 3.90.76.10 |
| 1uqwB02 | Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 | 0.885 | 37 | 179 | 3.90.76.10 |
| af_P76128_42_177_3.90.76.10 | Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 | 0.8691 | 42 | 182 | 3.90.76.10 |
| af_Q2FVE7_35_272_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.848 | 30 | 251 | 3.40.190.10 |
| af_P75797_27_224_3.10.105.10 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.8451 | 29 | 235 | 3.10.105.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0P9T8-F1-model_v4 | Solute-binding protein family 5 domain-containing protein | 0.9469 | 25 | 238 |
GO:0015031
GO:0015833 GO:0030313 GO:1904680 |
| AF-A0A537NQJ7-F1-model_v4 | ABC transporter substrate-binding protein | 0.9292 | 25 | 261 |
GO:0015031
GO:0015833 GO:0030313 GO:1904680 |
| AF-A0A538LCE5-F1-model_v4 | Solute-binding protein family 5 domain-containing protein | 0.9216 | 34 | 207 |
GO:0015833
GO:1904680 |
| AF-A0A7V9C1H1-F1-model_v4 | Solute-binding protein family 5 domain-containing protein | 0.911 | 185 | 528 |
GO:0015031
GO:0015833 GO:0030313 GO:1904680 |
| AF-A0A0S8KCM5-F1-model_v4 | Solute-binding protein family 5 domain-containing protein | 0.9067 | 19 | 528 |
GO:0015833
GO:0042597 GO:0043190 GO:1904680 |