F316866

General Info

Members Datasets Scaffolds Average Seq Length
207 154 207 146

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0031026|Ga0495629_0031026_249_773
Length 174
Sequence MMLAARRSPILWDAPHRKFSRRRKDPALNGDNLSEMGPIDYLLVEWPGRQPNGEVAPHLVDLVDRGLIRILDLAFIAKAEDGSVAGLELADVGGEVAELAIFEGAASGLLSDDDIGEAGAALEPGTSAALLVFENTWAAPFASAVRRSGGQLVASGRIPVQAILAALDAAETNS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 10.63
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003599 3300001979 Bacteria 6761
2 JGI25404J52841_10007520 3300003659 Bacteria 2305
3 Ga0070683_100140708 3300005329 Bacteria 2286
4 Ga0070682_100000080 3300005337 Bacteria 85683
5 Ga0070682_102070013 3300005337 Unclassified 502
6 Ga0068868_100002073 3300005338 Bacteria 13783
7 Ga0070689_100108658 3300005340 Bacteria 2204
8 Ga0070661_100000005 3300005344 Bacteria 220455
9 Ga0070692_10062030 3300005345 Bacteria 1972
10 Ga0070668_100100874 3300005347 Bacteria 2287
11 Ga0070674_100000004 3300005356 Bacteria 169446
12 Ga0070673_100020828 3300005364 Bacteria 4738
13 Ga0070688_100001024 3300005365 Bacteria 14017
14 Ga0070688_100002028 3300005365 Bacteria 10211
15 Ga0070667_100751172 3300005367 Bacteria 904
16 Ga0070714_100037310 3300005435 Bacteria 4083
17 Ga0070714_100122939 3300005435 Bacteria 2311
18 Ga0070713_100000760 3300005436 Bacteria 20641
19 Ga0070713_100058581 3300005436 Bacteria 3213
20 Ga0070711_101065568 3300005439 Bacteria 695
21 Ga0070711_101487798 3300005439 Bacteria 590
22 Ga0070700_101668874 3300005441 Bacteria 546
23 Ga0070663_100974184 3300005455 Bacteria 736
24 Ga0068867_100000556 3300005459 Bacteria 24623
25 Ga0070685_10002756 3300005466 Bacteria 9006
26 Ga0070685_10007157 3300005466 Bacteria 5699
27 Ga0070684_100214142 3300005535 Bacteria 1756
28 Ga0068853_100096319 3300005539 Bacteria 2611
29 Ga0070665_100000655 3300005548 Bacteria 46688
30 Ga0070665_100226266 3300005548 Bacteria 1871
31 Ga0070665_100869155 3300005548 Bacteria 915
32 Ga0068857_100234760 3300005577 Bacteria 1678
33 Ga0068854_100000212 3300005578 Bacteria 39011
34 Ga0068856_100000064 3300005614 Bacteria 98907
35 Ga0068856_100005082 3300005614 Bacteria 13012
36 Ga0068852_100090219 3300005616 Bacteria 2741
37 Ga0068859_102091891 3300005617 Bacteria 625
38 Ga0068866_10000004 3300005718 Bacteria 202810
39 Ga0068866_10009256 3300005718 Bacteria 4177
40 Ga0068851_10003103 3300005834 Bacteria 7358
41 Ga0068851_10016107 3300005834 Bacteria 3573
42 Ga0068863_100060697 3300005841 Bacteria 3576
43 Ga0068860_100024464 3300005843 Bacteria 5835
44 Ga0068862_102129273 3300005844 Bacteria 572
45 Ga0081455_10004125 3300005937 Bacteria 16429
46 Ga0081540_1000006 3300005983 Bacteria 208724
47 Ga0070715_10000014 3300006163 Bacteria 154272
48 Ga0070712_100013592 3300006175 Bacteria 5205
49 Ga0068865_100000017 3300006881 Bacteria 109636
50 Ga0105240_10494049 3300009093 Bacteria 1362
51 Ga0105245_10066677 3300009098 Bacteria 3258
52 Ga0105247_10000105 3300009101 Bacteria 87578
53 Ga0105247_10077589 3300009101 Bacteria 2088
54 Ga0105241_10122101 3300009174 Bacteria 2099
55 Ga0105242_10001190 3300009176 Bacteria 20519
56 Ga0105242_10003454 3300009176 Bacteria 12286
57 Ga0105237_10930970 3300009545 Unclassified 876
58 Ga0105249_10550248 3300009553 Bacteria 1205
59 Ga0105239_10090147 3300010375 Bacteria 3383
60 Ga0105239_10191035 3300010375 Bacteria 2292
61 Ga0157373_10767574 3300013100 Bacteria 709
62 Ga0157371_10064038 3300013102 Bacteria 2606
63 Ga0157378_10011430 3300013297 Bacteria 7770
64 Ga0157372_10025229 3300013307 Bacteria 6461
65 Ga0157380_10000028 3300014326 Bacteria 99836
66 Ga0157377_10241413 3300014745 Bacteria 1166
67 Ga0157379_10105022 3300014968 Bacteria 2535
68 Ga0206356_11075605 3300020070 Bacteria 2917
69 Ga0206356_11133739 3300020070 Bacteria 503
70 Ga0224712_10066922 3300022467 Bacteria 1448
71 Ga0207656_10000169 3300025321 Bacteria 24062
72 Ga0207656_10009510 3300025321 Bacteria 3612
73 Ga0207642_10000005 3300025899 Bacteria 401934
74 Ga0207710_10001368 3300025900 Bacteria 12241
75 Ga0207680_10001540 3300025903 Bacteria 10851
76 Ga0207685_10000046 3300025905 Bacteria 46018
77 Ga0207654_10080860 3300025911 Bacteria 1955
78 Ga0207695_10229934 3300025913 Bacteria 1759
79 Ga0207671_10101201 3300025914 Bacteria 2183
80 Ga0207693_10000853 3300025915 Bacteria 27203
81 Ga0207663_10170015 3300025916 Bacteria 1547
82 Ga0207649_10000005 3300025920 Bacteria 356179
83 Ga0207681_10063039 3300025923 Bacteria 2555
84 Ga0207687_10000007 3300025927 Bacteria 604185
85 Ga0207687_10021449 3300025927 Bacteria 4293
86 Ga0207700_10000008 3300025928 Bacteria 341717
87 Ga0207700_10000016 3300025928 Bacteria 202434
88 Ga0207700_10042818 3300025928 Bacteria 3322
89 Ga0207664_10010061 3300025929 Bacteria 6665
90 Ga0207686_10000032 3300025934 Bacteria 150341
91 Ga0207686_10000694 3300025934 Bacteria 20874
92 Ga0207670_10033738 3300025936 Bacteria 3301
93 Ga0207669_10000021 3300025937 Bacteria 100327
94 Ga0207704_10000025 3300025938 Bacteria 135523
95 Ga0207704_10097778 3300025938 Bacteria 1948
96 Ga0207661_10000164 3300025944 Bacteria 43091
97 Ga0207651_10001129 3300025960 Bacteria 11900
98 Ga0207712_10728685 3300025961 Bacteria 867
99 Ga0207668_11807410 3300025972 Bacteria 551
100 Ga0207640_10000137 3300025981 Bacteria 54133
101 Ga0207658_10410430 3300025986 Bacteria 1192
102 Ga0207677_10000914 3300026023 Bacteria 16530
103 Ga0207639_10069377 3300026041 Bacteria 2750
104 Ga0207678_10989526 3300026067 Bacteria 744
105 Ga0207702_10000016 3300026078 Bacteria 226633
106 Ga0207702_10003712 3300026078 Bacteria 13807
107 Ga0207641_10049209 3300026088 Bacteria 3561
108 Ga0207648_10001621 3300026089 Bacteria 24664
109 Ga0207674_10083900 3300026116 Bacteria 3185
110 Ga0207683_10098099 3300026121 Bacteria 2614
111 Ga0207698_10059585 3300026142 Bacteria 2965
112 Ga0207698_10921338 3300026142 Bacteria 882
113 Ga0268266_10000789 3300028379 Bacteria 42235
114 Ga0268266_10162217 3300028379 Bacteria 2023
115 Ga0268266_10419304 3300028379 Bacteria 1268
116 Ga0268264_10017636 3300028381 Bacteria 5845
117 Ga0268264_10916325 3300028381 Unclassified 880
118 Ga0265336_10225304 3300028666 Bacteria 557
119 Ga0316574_0233430 3300035398 Bacteria 1177
120 Ga0316582_0093802 3300036647 Bacteria 1980
121 Ga0451853_0120117 3300041512 Bacteria 2180
122 Ga0466963_0115624 3300044694 Bacteria 1843
123 Ga0495603_0000002 3300046455 Bacteria 86858
124 Ga0495629_0001755 3300046459 Bacteria 17004
125 Ga0495629_0031026 3300046459 Bacteria 3786
126 Ga0495629_0137263 3300046459 Bacteria 1702
127 Ga0495641_0081327 3300046461 Bacteria 1451
128 Ga0495662_0003962 3300046476 Bacteria 7467
129 Ga0495662_0018860 3300046476 Bacteria 3338
130 Ga0495606_0000057 3300046507 Bacteria 197956
131 Ga0495608_0000208 3300046511 Bacteria 42275
132 Ga0495630_0000025 3300046517 Bacteria 152364
133 Ga0495630_0115523 3300046517 Bacteria 2034
134 Ga0495637_0193719 3300046520 Bacteria 749
135 Ga0495652_0000003 3300046529 Bacteria 597094
136 Ga0495640_0110762 3300046533 Bacteria 1794
137 Ga0495587_0009402 3300046536 Bacteria 6266
138 Ga0495587_0113741 3300046536 Bacteria 1553
139 Ga0495621_0052502 3300046539 Bacteria 1461
140 Ga0495588_0000852 3300046674 Bacteria 13501
141 Ga0495657_0000406 3300046675 Bacteria 40241
142 Ga0495599_0100405 3300046678 Bacteria 1804
143 Ga0495647_0002122 3300046681 Bacteria 6198
144 Ga0495658_0000696 3300046683 Bacteria 18195
145 Ga0495624_0000241 3300046690 Bacteria 42989
146 Ga0495604_0000013 3300047317 Bacteria 234578
147 Ga0495604_0006256 3300047317 Bacteria 9443
148 Ga0495674_0000020 3300047319 Bacteria 178465
149 Ga0495672_0470172 3300047320 Bacteria 564
150 Ga0495676_0005500 3300047321 Bacteria 11621
151 Ga0495676_0011278 3300047321 Bacteria 8078
152 Ga0495676_0545208 3300047321 Bacteria 758
153 Ga0495680_0347339 3300047322 Bacteria 1033
154 Ga0495675_0000767 3300047444 Bacteria 20084
155 Ga0495675_0142252 3300047444 Bacteria 1486
156 Ga0495686_0062178 3300047472 Bacteria 2317
157 Ga0495686_0196457 3300047472 Bacteria 1160
158 Ga0495602_0000032 3300048088 Bacteria 141185
159 Ga0496100_0000049 3300048903 Bacteria 75590
160 Ga0496101_0000010 3300048904 Bacteria 281990
161 Ga0496102_0001529 3300048905 Bacteria 20416
162 Ga0496103_0000043 3300048906 Bacteria 167983
163 Ga0496104_0000002 3300048907 Bacteria 686017
164 Ga0496104_0266300 3300048907 Bacteria 1626
165 Ga0496104_0301850 3300048907 Bacteria 1513
166 Ga0496105_0000001 3300048908 Bacteria 1328178
167 Ga0496106_0000018 3300048909 Bacteria 175028
168 Ga0496107_0000032 3300048910 Bacteria 99848
169 Ga0496107_0435112 3300048910 Bacteria 975
170 Ga0496108_0027526 3300048911 Bacteria 4695
171 Ga0496109_0000252 3300048912 Bacteria 51599
172 Ga0496109_0192442 3300048912 Bacteria 1917
173 Ga0496110_0002687 3300048913 Bacteria 13431
174 Ga0496111_0000492 3300048914 Bacteria 20329
175 Ga0496111_1104356 3300048914 Bacteria 565
176 Ga0496112_0000006 3300048915 Bacteria 365227
177 Ga0496112_0093360 3300048915 Bacteria 2980
178 Ga0496113_0000411 3300048916 Bacteria 20739
179 Ga0496114_0000003 3300048917 Bacteria 630981
180 Ga0496115_0000036 3300048918 Bacteria 127774
181 Ga0496116_0000598 3300048919 Bacteria 47884
182 Ga0496118_0116719 3300048921 Bacteria 1753
183 Ga0496118_0538787 3300048921 Unclassified 572
184 Ga0496119_0000489 3300048922 Bacteria 54129
185 Ga0496119_0000710 3300048922 Bacteria 44696
186 Ga0496119_0046962 3300048922 Bacteria 2691
187 Ga0496119_0081176 3300048922 Bacteria 1868
188 Ga0496120_0526391 3300048923 Bacteria 505
189 Ga0496121_0017521 3300048924 Bacteria 7309
190 Ga0496121_0158296 3300048924 Bacteria 1659
191 Ga0496121_0477975 3300048924 Bacteria 796
192 Ga0496125_0298357 3300048928 Bacteria 988
193 Ga0501070_0003994 3300049586 Bacteria 12682
194 Ga0501070_0012329 3300049586 Bacteria 7213
195 Ga0501076_0346642 3300049592 Bacteria 1219
196 Ga0501035_0799937 3300049822 Bacteria 753
197 Ga0495601_0126151 3300053077 Bacteria 1665
198 Ga0495601_0643619 3300053077 Bacteria 678
199 Ga0495612_0006476 3300053078 Bacteria 4810
200 Ga0495655_0000011 3300053083 Bacteria 118490
201 Ga0495655_0001994 3300053083 Bacteria 3194
202 Ga0495595_0000091 3300053084 Bacteria 42155
203 Ga0495595_0009491 3300053084 Bacteria 4027
204 Ga0495619_0000022 3300053085 Bacteria 184144
205 Ga0495619_0000141 3300053085 Bacteria 53921
206 Ga0500566_0006347 3300053094 Bacteria 7021
207 Ga0500628_000032 3300053129 Bacteria 52752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0233430 Ga0316574_0233430_582_1019 135
2 3300036647 Ga0316582_0093802 Ga0316582_0093802_1175_1615 138
3 3300048919 Ga0496116_0000598 Ga0496116_0000598_20279_20710 140
4 3300048921 Ga0496118_0116719 Ga0496118_0116719_949_1380 140
5 3300048922 Ga0496119_0000489 Ga0496119_0000489_27140_27571 140
6 3300048923 Ga0496120_0526391 Ga0496120_0526391_23_454 140
7 3300005718 Ga0068866_10009256 Ga0068866_100092566 141
8 3300005614 Ga0068856_100000064 Ga0068856_10000006427 142
9 3300026078 Ga0207702_10000016 Ga0207702_1000001654 142
10 3300047317 Ga0495604_0006256 Ga0495604_0006256_7263_7694 142
11 3300048088 Ga0495602_0000032 Ga0495602_0000032_17616_18047 142
12 3300053084 Ga0495595_0009491 Ga0495595_0009491_512_943 142
13 3300005344 Ga0070661_100000005 Ga0070661_100000005160 143
14 3300005365 Ga0070688_100001024 Ga0070688_1000010244 143
15 3300005365 Ga0070688_100002028 Ga0070688_10000202810 143
16 3300005435 Ga0070714_100037310 Ga0070714_1000373105 143
17 3300005466 Ga0070685_10002756 Ga0070685_100027568 143
18 3300005466 Ga0070685_10007157 Ga0070685_100071574 143
19 3300005548 Ga0070665_100226266 Ga0070665_1002262662 143
20 3300005937 Ga0081455_10004125 Ga0081455_1000412515 143
21 3300006881 Ga0068865_100000017 Ga0068865_10000001758 143
22 3300009176 Ga0105242_10001190 Ga0105242_1000119021 143
23 3300009176 Ga0105242_10003454 Ga0105242_100034544 143
24 3300013100 Ga0157373_10767574 Ga0157373_107675742 143
25 3300014745 Ga0157377_10241413 Ga0157377_102414132 143
26 3300025920 Ga0207649_10000005 Ga0207649_10000005303 143
27 3300025929 Ga0207664_10010061 Ga0207664_100100614 143
28 3300025934 Ga0207686_10000032 Ga0207686_1000003259 143
29 3300025934 Ga0207686_10000694 Ga0207686_1000069414 143
30 3300025938 Ga0207704_10000025 Ga0207704_1000002549 143
31 3300025938 Ga0207704_10097778 Ga0207704_100977782 143
32 3300028379 Ga0268266_10162217 Ga0268266_101622173 143
33 3300041512 Ga0451853_0120117 Ga0451853_0120117_1247_1684 143
34 3300046459 Ga0495629_0137263 Ga0495629_0137263_1196_1633 143
35 3300046529 Ga0495652_0000003 Ga0495652_0000003_76305_76742 143
36 3300046536 Ga0495587_0113741 Ga0495587_0113741_1013_1450 143
37 3300046678 Ga0495599_0100405 Ga0495599_0100405_1096_1533 143
38 3300048907 Ga0496104_0000002 Ga0496104_0000002_573782_574213 143
39 3300048908 Ga0496105_0000001 Ga0496105_0000001_753966_754397 143
40 3300048922 Ga0496119_0081176 Ga0496119_0081176_726_1157 143
41 3300049592 Ga0501076_0346642 Ga0501076_0346642_21_458 143
42 3300053077 Ga0495601_0126151 Ga0495601_0126151_789_1226 143
43 3300053094 Ga0500566_0006347 Ga0500566_0006347_792_1229 143
44 3300003659 JGI25404J52841_10007520 JGI25404J52841_100075204 144
45 3300005329 Ga0070683_100140708 Ga0070683_1001407083 144
46 3300005337 Ga0070682_100000080 Ga0070682_1000000808 144
47 3300005338 Ga0068868_100002073 Ga0068868_10000207314 144
48 3300005340 Ga0070689_100108658 Ga0070689_1001086582 144
49 3300005345 Ga0070692_10062030 Ga0070692_100620302 144
50 3300005347 Ga0070668_100100874 Ga0070668_1001008743 144
51 3300005356 Ga0070674_100000004 Ga0070674_10000000419 144
52 3300005364 Ga0070673_100020828 Ga0070673_1000208282 144
53 3300005367 Ga0070667_100751172 Ga0070667_1007511722 144
54 3300005435 Ga0070714_100122939 Ga0070714_1001229393 144
55 3300005436 Ga0070713_100000760 Ga0070713_10000076015 144
56 3300005436 Ga0070713_100058581 Ga0070713_1000585814 144
57 3300005439 Ga0070711_101065568 Ga0070711_1010655681 144
58 3300005439 Ga0070711_101487798 Ga0070711_1014877981 144
59 3300005441 Ga0070700_101668874 Ga0070700_1016688741 144
60 3300005455 Ga0070663_100974184 Ga0070663_1009741842 144
61 3300005459 Ga0068867_100000556 Ga0068867_10000055624 144
62 3300005535 Ga0070684_100214142 Ga0070684_1002141422 144
63 3300005539 Ga0068853_100096319 Ga0068853_1000963194 144
64 3300005548 Ga0070665_100000655 Ga0070665_1000006553 144
65 3300005548 Ga0070665_100869155 Ga0070665_1008691552 144
66 3300005577 Ga0068857_100234760 Ga0068857_1002347603 144
67 3300005578 Ga0068854_100000212 Ga0068854_10000021234 144
68 3300005614 Ga0068856_100005082 Ga0068856_1000050826 144
69 3300005616 Ga0068852_100090219 Ga0068852_1000902194 144
70 3300005617 Ga0068859_102091891 Ga0068859_1020918912 144
71 3300005718 Ga0068866_10000004 Ga0068866_1000000456 144
72 3300005834 Ga0068851_10003103 Ga0068851_100031038 144
73 3300005834 Ga0068851_10016107 Ga0068851_100161073 144
74 3300005841 Ga0068863_100060697 Ga0068863_1000606975 144
75 3300005843 Ga0068860_100024464 Ga0068860_1000244645 144
76 3300005844 Ga0068862_102129273 Ga0068862_1021292731 144
77 3300005983 Ga0081540_1000006 Ga0081540_10000065 144
78 3300006163 Ga0070715_10000014 Ga0070715_1000001415 144
79 3300006175 Ga0070712_100013592 Ga0070712_1000135928 144
80 3300009098 Ga0105245_10066677 Ga0105245_100666773 144
81 3300009101 Ga0105247_10000105 Ga0105247_100001058 144
82 3300009101 Ga0105247_10077589 Ga0105247_100775892 144
83 3300009174 Ga0105241_10122101 Ga0105241_101221012 144
84 3300009553 Ga0105249_10550248 Ga0105249_105502483 144
85 3300010375 Ga0105239_10090147 Ga0105239_100901473 144
86 3300013102 Ga0157371_10064038 Ga0157371_100640382 144
87 3300013297 Ga0157378_10011430 Ga0157378_100114306 144
88 3300013307 Ga0157372_10025229 Ga0157372_100252292 144
89 3300014326 Ga0157380_10000028 Ga0157380_1000002871 144
90 3300014968 Ga0157379_10105022 Ga0157379_101050223 144
91 3300020070 Ga0206356_11075605 Ga0206356_110756054 144
92 3300020070 Ga0206356_11133739 Ga0206356_111337391 144
93 3300022467 Ga0224712_10066922 Ga0224712_100669223 144
94 3300025321 Ga0207656_10000169 Ga0207656_100001692 144
95 3300025321 Ga0207656_10009510 Ga0207656_100095103 144
96 3300025899 Ga0207642_10000005 Ga0207642_10000005151 144
97 3300025900 Ga0207710_10001368 Ga0207710_100013686 144
98 3300025903 Ga0207680_10001540 Ga0207680_1000154011 144
99 3300025905 Ga0207685_10000046 Ga0207685_1000004614 144
100 3300025911 Ga0207654_10080860 Ga0207654_100808602 144
101 3300025915 Ga0207693_10000853 Ga0207693_1000085328 144
102 3300025916 Ga0207663_10170015 Ga0207663_101700153 144
103 3300025923 Ga0207681_10063039 Ga0207681_100630393 144
104 3300025927 Ga0207687_10000007 Ga0207687_1000000765 144
105 3300025927 Ga0207687_10021449 Ga0207687_100214494 144
106 3300025928 Ga0207700_10000008 Ga0207700_10000008284 144
107 3300025928 Ga0207700_10000016 Ga0207700_1000001663 144
108 3300025928 Ga0207700_10042818 Ga0207700_100428184 144
109 3300025936 Ga0207670_10033738 Ga0207670_100337383 144
110 3300025937 Ga0207669_10000021 Ga0207669_1000002176 144
111 3300025944 Ga0207661_10000164 Ga0207661_1000016431 144
112 3300025960 Ga0207651_10001129 Ga0207651_100011293 144
113 3300025961 Ga0207712_10728685 Ga0207712_107286852 144
114 3300025972 Ga0207668_11807410 Ga0207668_118074101 144
115 3300025981 Ga0207640_10000137 Ga0207640_100001379 144
116 3300025986 Ga0207658_10410430 Ga0207658_104104302 144
117 3300026023 Ga0207677_10000914 Ga0207677_100009144 144
118 3300026041 Ga0207639_10069377 Ga0207639_100693774 144
119 3300026067 Ga0207678_10989526 Ga0207678_109895261 144
120 3300026078 Ga0207702_10003712 Ga0207702_1000371210 144
121 3300026088 Ga0207641_10049209 Ga0207641_100492095 144
122 3300026089 Ga0207648_10001621 Ga0207648_100016216 144
123 3300026116 Ga0207674_10083900 Ga0207674_100839005 144
124 3300026121 Ga0207683_10098099 Ga0207683_100980995 144
125 3300026142 Ga0207698_10059585 Ga0207698_100595852 144
126 3300026142 Ga0207698_10921338 Ga0207698_109213382 144
127 3300028379 Ga0268266_10000789 Ga0268266_1000078920 144
128 3300028379 Ga0268266_10419304 Ga0268266_104193041 144
129 3300028381 Ga0268264_10017636 Ga0268264_100176363 144
130 3300028381 Ga0268264_10916325 Ga0268264_109163252 144
131 3300028666 Ga0265336_10225304 Ga0265336_102253041 144
132 3300044694 Ga0466963_0115624 Ga0466963_0115624_61_501 144
133 3300046459 Ga0495629_0001755 Ga0495629_0001755_3395_3832 144
134 3300046459 Ga0495629_0031026 Ga0495629_0031026_249_773 144
135 3300046461 Ga0495641_0081327 Ga0495641_0081327_518_952 144
136 3300046476 Ga0495662_0003962 Ga0495662_0003962_3456_3890 144
137 3300046476 Ga0495662_0018860 Ga0495662_0018860_1571_2014 144
138 3300046507 Ga0495606_0000057 Ga0495606_0000057_3152_3589 144
139 3300046511 Ga0495608_0000208 Ga0495608_0000208_40014_40451 144
140 3300046517 Ga0495630_0000025 Ga0495630_0000025_47060_47494 144
141 3300046517 Ga0495630_0115523 Ga0495630_0115523_1192_1635 144
142 3300046520 Ga0495637_0193719 Ga0495637_0193719_275_712 144
143 3300046533 Ga0495640_0110762 Ga0495640_0110762_1055_1498 144
144 3300046536 Ga0495587_0009402 Ga0495587_0009402_2041_2523 144
145 3300046539 Ga0495621_0052502 Ga0495621_0052502_672_1118 144
146 3300046674 Ga0495588_0000852 Ga0495588_0000852_9311_9748 144
147 3300046675 Ga0495657_0000406 Ga0495657_0000406_1825_2262 144
148 3300046681 Ga0495647_0002122 Ga0495647_0002122_2661_3095 144
149 3300046683 Ga0495658_0000696 Ga0495658_0000696_4846_5286 144
150 3300046690 Ga0495624_0000241 Ga0495624_0000241_3400_3834 144
151 3300047317 Ga0495604_0000013 Ga0495604_0000013_186531_186968 144
152 3300047319 Ga0495674_0000020 Ga0495674_0000020_149244_149687 144
153 3300047320 Ga0495672_0470172 Ga0495672_0470172_56_502 144
154 3300047321 Ga0495676_0005500 Ga0495676_0005500_9871_10311 144
155 3300047321 Ga0495676_0011278 Ga0495676_0011278_7213_7656 144
156 3300047321 Ga0495676_0545208 Ga0495676_0545208_306_740 144
157 3300047322 Ga0495680_0347339 Ga0495680_0347339_473_916 144
158 3300047444 Ga0495675_0000767 Ga0495675_0000767_17009_17446 144
159 3300047444 Ga0495675_0142252 Ga0495675_0142252_607_1050 144
160 3300047472 Ga0495686_0062178 Ga0495686_0062178_966_1409 144
161 3300048903 Ga0496100_0000049 Ga0496100_0000049_42681_43121 144
162 3300048904 Ga0496101_0000010 Ga0496101_0000010_57439_57879 144
163 3300048905 Ga0496102_0001529 Ga0496102_0001529_110_550 144
164 3300048906 Ga0496103_0000043 Ga0496103_0000043_147677_148117 144
165 3300048907 Ga0496104_0266300 Ga0496104_0266300_996_1433 144
166 3300048909 Ga0496106_0000018 Ga0496106_0000018_15400_15840 144
167 3300048910 Ga0496107_0000032 Ga0496107_0000032_42018_42458 144
168 3300048911 Ga0496108_0027526 Ga0496108_0027526_3443_3880 144
169 3300048912 Ga0496109_0000252 Ga0496109_0000252_31743_32180 144
170 3300048912 Ga0496109_0192442 Ga0496109_0192442_1438_1872 144
171 3300048913 Ga0496110_0002687 Ga0496110_0002687_5366_5803 144
172 3300048914 Ga0496111_0000492 Ga0496111_0000492_7643_8080 144
173 3300048914 Ga0496111_1104356 Ga0496111_1104356_78_515 144
174 3300048915 Ga0496112_0000006 Ga0496112_0000006_213377_213817 144
175 3300048915 Ga0496112_0093360 Ga0496112_0093360_1095_1529 144
176 3300048916 Ga0496113_0000411 Ga0496113_0000411_16750_17184 144
177 3300048917 Ga0496114_0000003 Ga0496114_0000003_209182_209622 144
178 3300048918 Ga0496115_0000036 Ga0496115_0000036_60146_60586 144
179 3300048921 Ga0496118_0538787 Ga0496118_0538787_34_474 144
180 3300049586 Ga0501070_0003994 Ga0501070_0003994_10704_11153 144
181 3300049586 Ga0501070_0012329 Ga0501070_0012329_3081_3521 144
182 3300053077 Ga0495601_0643619 Ga0495601_0643619_199_639 144
183 3300053078 Ga0495612_0006476 Ga0495612_0006476_1734_2171 144
184 3300053083 Ga0495655_0000011 Ga0495655_0000011_10714_11154 144
185 3300053083 Ga0495655_0001994 Ga0495655_0001994_1144_1581 144
186 3300053084 Ga0495595_0000091 Ga0495595_0000091_1825_2262 144
187 3300053085 Ga0495619_0000022 Ga0495619_0000022_76116_76553 144
188 3300053085 Ga0495619_0000141 Ga0495619_0000141_15464_15901 144
189 3300053129 Ga0500628_000032 Ga0500628_000032_11519_11959 144
190 3300001979 JGI24740J21852_10003599 JGI24740J21852_100035998 145
191 3300005337 Ga0070682_102070013 Ga0070682_1020700131 145
192 3300009093 Ga0105240_10494049 Ga0105240_104940492 145
193 3300009545 Ga0105237_10930970 Ga0105237_109309702 145
194 3300010375 Ga0105239_10191035 Ga0105239_101910351 145
195 3300025913 Ga0207695_10229934 Ga0207695_102299343 145
196 3300025914 Ga0207671_10101201 Ga0207671_101012012 145
197 3300046455 Ga0495603_0000002 Ga0495603_0000002_35444_35890 145
198 3300047472 Ga0495686_0196457 Ga0495686_0196457_260_700 145
199 3300048907 Ga0496104_0301850 Ga0496104_0301850_550_990 145
200 3300048910 Ga0496107_0435112 Ga0496107_0435112_356_796 145
201 3300048922 Ga0496119_0000710 Ga0496119_0000710_2335_2775 145
202 3300048922 Ga0496119_0046962 Ga0496119_0046962_1543_1983 145
203 3300048924 Ga0496121_0017521 Ga0496121_0017521_417_857 145
204 3300048924 Ga0496121_0158296 Ga0496121_0158296_265_705 145
205 3300048924 Ga0496121_0477975 Ga0496121_0477975_17_457 145
206 3300048928 Ga0496125_0298357 Ga0496125_0298357_248_688 145
207 3300049822 Ga0501035_0799937 Ga0501035_0799937_261_704 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19850

DUF6325

Family of unknown function (DUF6325)

35

173

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gs0-assembly2.cif.gz_L crystal structure of the complex of tlr3 and bi-specific diabody 0.61 38 59
3gs2-assembly1.cif.gz_A ring1b c-terminal domain/cbx7 cbox complex 0.6079 45 70
6gq8-assembly1.cif.gz_D superoxide reductase from nanoarchaeum equitans 0.595 39 60
5etl-assembly1.cif.gz_A e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution 0.5791 11 107
5hr4-assembly1.cif.gz_C structure of type iil restriction-modification enzyme mmei in complex with dna has implications for engineering of new specificities 0.5588 11 106
ID Description Score Start End Superfamily
3zjvA04 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.6182 45 63 2.20.28.290
af_Q19585_99_334_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6017 39 58 3.40.50.300
af_O17303_154_262_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.5981 36 60 2.60.210.10
6gq8B00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.5868 39 60 2.60.40.730
af_Q5U334_33_148_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5842 40 58 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2U1EDB8-F1-model_v4 Putative hydrophobic protein (TIGR00271 family) 0.8628 7 141 GO:0016020
AF-A0A1H7MI81-F1-model_v4 Uncharacterized protein 0.8625 8 131
AF-A0A3G4W275-F1-model_v4 DUF1269 domain-containing protein 0.861 7 143
AF-A0A222TIR9-F1-model_v4 deleted 0.8582 7 143
AF-A0A4R7HX69-F1-model_v4 DUF1269 domain-containing protein 0.858 1 145

Feature Viewer

pLDDT pTM Quality
81.1 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map