F316866
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 207 | 154 | 207 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0031026|Ga0495629_0031026_249_773 |
| Length | 174 |
| Sequence | MMLAARRSPILWDAPHRKFSRRRKDPALNGDNLSEMGPIDYLLVEWPGRQPNGEVAPHLVDLVDRGLIRILDLAFIAKAEDGSVAGLELADVGGEVAELAIFEGAASGLLSDDDIGEAGAALEPGTSAALLVFENTWAAPFASAVRRSGGQLVASGRIPVQAILAALDAAETNS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 94 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 95 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 129 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 136 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 139 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 140 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 1.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 10.63 |
| Rhizosphere | 82.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003599 | 3300001979 | Bacteria | 6761 |
| 2 | JGI25404J52841_10007520 | 3300003659 | Bacteria | 2305 |
| 3 | Ga0070683_100140708 | 3300005329 | Bacteria | 2286 |
| 4 | Ga0070682_100000080 | 3300005337 | Bacteria | 85683 |
| 5 | Ga0070682_102070013 | 3300005337 | Unclassified | 502 |
| 6 | Ga0068868_100002073 | 3300005338 | Bacteria | 13783 |
| 7 | Ga0070689_100108658 | 3300005340 | Bacteria | 2204 |
| 8 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 9 | Ga0070692_10062030 | 3300005345 | Bacteria | 1972 |
| 10 | Ga0070668_100100874 | 3300005347 | Bacteria | 2287 |
| 11 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 12 | Ga0070673_100020828 | 3300005364 | Bacteria | 4738 |
| 13 | Ga0070688_100001024 | 3300005365 | Bacteria | 14017 |
| 14 | Ga0070688_100002028 | 3300005365 | Bacteria | 10211 |
| 15 | Ga0070667_100751172 | 3300005367 | Bacteria | 904 |
| 16 | Ga0070714_100037310 | 3300005435 | Bacteria | 4083 |
| 17 | Ga0070714_100122939 | 3300005435 | Bacteria | 2311 |
| 18 | Ga0070713_100000760 | 3300005436 | Bacteria | 20641 |
| 19 | Ga0070713_100058581 | 3300005436 | Bacteria | 3213 |
| 20 | Ga0070711_101065568 | 3300005439 | Bacteria | 695 |
| 21 | Ga0070711_101487798 | 3300005439 | Bacteria | 590 |
| 22 | Ga0070700_101668874 | 3300005441 | Bacteria | 546 |
| 23 | Ga0070663_100974184 | 3300005455 | Bacteria | 736 |
| 24 | Ga0068867_100000556 | 3300005459 | Bacteria | 24623 |
| 25 | Ga0070685_10002756 | 3300005466 | Bacteria | 9006 |
| 26 | Ga0070685_10007157 | 3300005466 | Bacteria | 5699 |
| 27 | Ga0070684_100214142 | 3300005535 | Bacteria | 1756 |
| 28 | Ga0068853_100096319 | 3300005539 | Bacteria | 2611 |
| 29 | Ga0070665_100000655 | 3300005548 | Bacteria | 46688 |
| 30 | Ga0070665_100226266 | 3300005548 | Bacteria | 1871 |
| 31 | Ga0070665_100869155 | 3300005548 | Bacteria | 915 |
| 32 | Ga0068857_100234760 | 3300005577 | Bacteria | 1678 |
| 33 | Ga0068854_100000212 | 3300005578 | Bacteria | 39011 |
| 34 | Ga0068856_100000064 | 3300005614 | Bacteria | 98907 |
| 35 | Ga0068856_100005082 | 3300005614 | Bacteria | 13012 |
| 36 | Ga0068852_100090219 | 3300005616 | Bacteria | 2741 |
| 37 | Ga0068859_102091891 | 3300005617 | Bacteria | 625 |
| 38 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 39 | Ga0068866_10009256 | 3300005718 | Bacteria | 4177 |
| 40 | Ga0068851_10003103 | 3300005834 | Bacteria | 7358 |
| 41 | Ga0068851_10016107 | 3300005834 | Bacteria | 3573 |
| 42 | Ga0068863_100060697 | 3300005841 | Bacteria | 3576 |
| 43 | Ga0068860_100024464 | 3300005843 | Bacteria | 5835 |
| 44 | Ga0068862_102129273 | 3300005844 | Bacteria | 572 |
| 45 | Ga0081455_10004125 | 3300005937 | Bacteria | 16429 |
| 46 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 47 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 48 | Ga0070712_100013592 | 3300006175 | Bacteria | 5205 |
| 49 | Ga0068865_100000017 | 3300006881 | Bacteria | 109636 |
| 50 | Ga0105240_10494049 | 3300009093 | Bacteria | 1362 |
| 51 | Ga0105245_10066677 | 3300009098 | Bacteria | 3258 |
| 52 | Ga0105247_10000105 | 3300009101 | Bacteria | 87578 |
| 53 | Ga0105247_10077589 | 3300009101 | Bacteria | 2088 |
| 54 | Ga0105241_10122101 | 3300009174 | Bacteria | 2099 |
| 55 | Ga0105242_10001190 | 3300009176 | Bacteria | 20519 |
| 56 | Ga0105242_10003454 | 3300009176 | Bacteria | 12286 |
| 57 | Ga0105237_10930970 | 3300009545 | Unclassified | 876 |
| 58 | Ga0105249_10550248 | 3300009553 | Bacteria | 1205 |
| 59 | Ga0105239_10090147 | 3300010375 | Bacteria | 3383 |
| 60 | Ga0105239_10191035 | 3300010375 | Bacteria | 2292 |
| 61 | Ga0157373_10767574 | 3300013100 | Bacteria | 709 |
| 62 | Ga0157371_10064038 | 3300013102 | Bacteria | 2606 |
| 63 | Ga0157378_10011430 | 3300013297 | Bacteria | 7770 |
| 64 | Ga0157372_10025229 | 3300013307 | Bacteria | 6461 |
| 65 | Ga0157380_10000028 | 3300014326 | Bacteria | 99836 |
| 66 | Ga0157377_10241413 | 3300014745 | Bacteria | 1166 |
| 67 | Ga0157379_10105022 | 3300014968 | Bacteria | 2535 |
| 68 | Ga0206356_11075605 | 3300020070 | Bacteria | 2917 |
| 69 | Ga0206356_11133739 | 3300020070 | Bacteria | 503 |
| 70 | Ga0224712_10066922 | 3300022467 | Bacteria | 1448 |
| 71 | Ga0207656_10000169 | 3300025321 | Bacteria | 24062 |
| 72 | Ga0207656_10009510 | 3300025321 | Bacteria | 3612 |
| 73 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 74 | Ga0207710_10001368 | 3300025900 | Bacteria | 12241 |
| 75 | Ga0207680_10001540 | 3300025903 | Bacteria | 10851 |
| 76 | Ga0207685_10000046 | 3300025905 | Bacteria | 46018 |
| 77 | Ga0207654_10080860 | 3300025911 | Bacteria | 1955 |
| 78 | Ga0207695_10229934 | 3300025913 | Bacteria | 1759 |
| 79 | Ga0207671_10101201 | 3300025914 | Bacteria | 2183 |
| 80 | Ga0207693_10000853 | 3300025915 | Bacteria | 27203 |
| 81 | Ga0207663_10170015 | 3300025916 | Bacteria | 1547 |
| 82 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 83 | Ga0207681_10063039 | 3300025923 | Bacteria | 2555 |
| 84 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 85 | Ga0207687_10021449 | 3300025927 | Bacteria | 4293 |
| 86 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 87 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 88 | Ga0207700_10042818 | 3300025928 | Bacteria | 3322 |
| 89 | Ga0207664_10010061 | 3300025929 | Bacteria | 6665 |
| 90 | Ga0207686_10000032 | 3300025934 | Bacteria | 150341 |
| 91 | Ga0207686_10000694 | 3300025934 | Bacteria | 20874 |
| 92 | Ga0207670_10033738 | 3300025936 | Bacteria | 3301 |
| 93 | Ga0207669_10000021 | 3300025937 | Bacteria | 100327 |
| 94 | Ga0207704_10000025 | 3300025938 | Bacteria | 135523 |
| 95 | Ga0207704_10097778 | 3300025938 | Bacteria | 1948 |
| 96 | Ga0207661_10000164 | 3300025944 | Bacteria | 43091 |
| 97 | Ga0207651_10001129 | 3300025960 | Bacteria | 11900 |
| 98 | Ga0207712_10728685 | 3300025961 | Bacteria | 867 |
| 99 | Ga0207668_11807410 | 3300025972 | Bacteria | 551 |
| 100 | Ga0207640_10000137 | 3300025981 | Bacteria | 54133 |
| 101 | Ga0207658_10410430 | 3300025986 | Bacteria | 1192 |
| 102 | Ga0207677_10000914 | 3300026023 | Bacteria | 16530 |
| 103 | Ga0207639_10069377 | 3300026041 | Bacteria | 2750 |
| 104 | Ga0207678_10989526 | 3300026067 | Bacteria | 744 |
| 105 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 106 | Ga0207702_10003712 | 3300026078 | Bacteria | 13807 |
| 107 | Ga0207641_10049209 | 3300026088 | Bacteria | 3561 |
| 108 | Ga0207648_10001621 | 3300026089 | Bacteria | 24664 |
| 109 | Ga0207674_10083900 | 3300026116 | Bacteria | 3185 |
| 110 | Ga0207683_10098099 | 3300026121 | Bacteria | 2614 |
| 111 | Ga0207698_10059585 | 3300026142 | Bacteria | 2965 |
| 112 | Ga0207698_10921338 | 3300026142 | Bacteria | 882 |
| 113 | Ga0268266_10000789 | 3300028379 | Bacteria | 42235 |
| 114 | Ga0268266_10162217 | 3300028379 | Bacteria | 2023 |
| 115 | Ga0268266_10419304 | 3300028379 | Bacteria | 1268 |
| 116 | Ga0268264_10017636 | 3300028381 | Bacteria | 5845 |
| 117 | Ga0268264_10916325 | 3300028381 | Unclassified | 880 |
| 118 | Ga0265336_10225304 | 3300028666 | Bacteria | 557 |
| 119 | Ga0316574_0233430 | 3300035398 | Bacteria | 1177 |
| 120 | Ga0316582_0093802 | 3300036647 | Bacteria | 1980 |
| 121 | Ga0451853_0120117 | 3300041512 | Bacteria | 2180 |
| 122 | Ga0466963_0115624 | 3300044694 | Bacteria | 1843 |
| 123 | Ga0495603_0000002 | 3300046455 | Bacteria | 86858 |
| 124 | Ga0495629_0001755 | 3300046459 | Bacteria | 17004 |
| 125 | Ga0495629_0031026 | 3300046459 | Bacteria | 3786 |
| 126 | Ga0495629_0137263 | 3300046459 | Bacteria | 1702 |
| 127 | Ga0495641_0081327 | 3300046461 | Bacteria | 1451 |
| 128 | Ga0495662_0003962 | 3300046476 | Bacteria | 7467 |
| 129 | Ga0495662_0018860 | 3300046476 | Bacteria | 3338 |
| 130 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 131 | Ga0495608_0000208 | 3300046511 | Bacteria | 42275 |
| 132 | Ga0495630_0000025 | 3300046517 | Bacteria | 152364 |
| 133 | Ga0495630_0115523 | 3300046517 | Bacteria | 2034 |
| 134 | Ga0495637_0193719 | 3300046520 | Bacteria | 749 |
| 135 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 136 | Ga0495640_0110762 | 3300046533 | Bacteria | 1794 |
| 137 | Ga0495587_0009402 | 3300046536 | Bacteria | 6266 |
| 138 | Ga0495587_0113741 | 3300046536 | Bacteria | 1553 |
| 139 | Ga0495621_0052502 | 3300046539 | Bacteria | 1461 |
| 140 | Ga0495588_0000852 | 3300046674 | Bacteria | 13501 |
| 141 | Ga0495657_0000406 | 3300046675 | Bacteria | 40241 |
| 142 | Ga0495599_0100405 | 3300046678 | Bacteria | 1804 |
| 143 | Ga0495647_0002122 | 3300046681 | Bacteria | 6198 |
| 144 | Ga0495658_0000696 | 3300046683 | Bacteria | 18195 |
| 145 | Ga0495624_0000241 | 3300046690 | Bacteria | 42989 |
| 146 | Ga0495604_0000013 | 3300047317 | Bacteria | 234578 |
| 147 | Ga0495604_0006256 | 3300047317 | Bacteria | 9443 |
| 148 | Ga0495674_0000020 | 3300047319 | Bacteria | 178465 |
| 149 | Ga0495672_0470172 | 3300047320 | Bacteria | 564 |
| 150 | Ga0495676_0005500 | 3300047321 | Bacteria | 11621 |
| 151 | Ga0495676_0011278 | 3300047321 | Bacteria | 8078 |
| 152 | Ga0495676_0545208 | 3300047321 | Bacteria | 758 |
| 153 | Ga0495680_0347339 | 3300047322 | Bacteria | 1033 |
| 154 | Ga0495675_0000767 | 3300047444 | Bacteria | 20084 |
| 155 | Ga0495675_0142252 | 3300047444 | Bacteria | 1486 |
| 156 | Ga0495686_0062178 | 3300047472 | Bacteria | 2317 |
| 157 | Ga0495686_0196457 | 3300047472 | Bacteria | 1160 |
| 158 | Ga0495602_0000032 | 3300048088 | Bacteria | 141185 |
| 159 | Ga0496100_0000049 | 3300048903 | Bacteria | 75590 |
| 160 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 161 | Ga0496102_0001529 | 3300048905 | Bacteria | 20416 |
| 162 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 163 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 164 | Ga0496104_0266300 | 3300048907 | Bacteria | 1626 |
| 165 | Ga0496104_0301850 | 3300048907 | Bacteria | 1513 |
| 166 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 167 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 168 | Ga0496107_0000032 | 3300048910 | Bacteria | 99848 |
| 169 | Ga0496107_0435112 | 3300048910 | Bacteria | 975 |
| 170 | Ga0496108_0027526 | 3300048911 | Bacteria | 4695 |
| 171 | Ga0496109_0000252 | 3300048912 | Bacteria | 51599 |
| 172 | Ga0496109_0192442 | 3300048912 | Bacteria | 1917 |
| 173 | Ga0496110_0002687 | 3300048913 | Bacteria | 13431 |
| 174 | Ga0496111_0000492 | 3300048914 | Bacteria | 20329 |
| 175 | Ga0496111_1104356 | 3300048914 | Bacteria | 565 |
| 176 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 177 | Ga0496112_0093360 | 3300048915 | Bacteria | 2980 |
| 178 | Ga0496113_0000411 | 3300048916 | Bacteria | 20739 |
| 179 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 180 | Ga0496115_0000036 | 3300048918 | Bacteria | 127774 |
| 181 | Ga0496116_0000598 | 3300048919 | Bacteria | 47884 |
| 182 | Ga0496118_0116719 | 3300048921 | Bacteria | 1753 |
| 183 | Ga0496118_0538787 | 3300048921 | Unclassified | 572 |
| 184 | Ga0496119_0000489 | 3300048922 | Bacteria | 54129 |
| 185 | Ga0496119_0000710 | 3300048922 | Bacteria | 44696 |
| 186 | Ga0496119_0046962 | 3300048922 | Bacteria | 2691 |
| 187 | Ga0496119_0081176 | 3300048922 | Bacteria | 1868 |
| 188 | Ga0496120_0526391 | 3300048923 | Bacteria | 505 |
| 189 | Ga0496121_0017521 | 3300048924 | Bacteria | 7309 |
| 190 | Ga0496121_0158296 | 3300048924 | Bacteria | 1659 |
| 191 | Ga0496121_0477975 | 3300048924 | Bacteria | 796 |
| 192 | Ga0496125_0298357 | 3300048928 | Bacteria | 988 |
| 193 | Ga0501070_0003994 | 3300049586 | Bacteria | 12682 |
| 194 | Ga0501070_0012329 | 3300049586 | Bacteria | 7213 |
| 195 | Ga0501076_0346642 | 3300049592 | Bacteria | 1219 |
| 196 | Ga0501035_0799937 | 3300049822 | Bacteria | 753 |
| 197 | Ga0495601_0126151 | 3300053077 | Bacteria | 1665 |
| 198 | Ga0495601_0643619 | 3300053077 | Bacteria | 678 |
| 199 | Ga0495612_0006476 | 3300053078 | Bacteria | 4810 |
| 200 | Ga0495655_0000011 | 3300053083 | Bacteria | 118490 |
| 201 | Ga0495655_0001994 | 3300053083 | Bacteria | 3194 |
| 202 | Ga0495595_0000091 | 3300053084 | Bacteria | 42155 |
| 203 | Ga0495595_0009491 | 3300053084 | Bacteria | 4027 |
| 204 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 205 | Ga0495619_0000141 | 3300053085 | Bacteria | 53921 |
| 206 | Ga0500566_0006347 | 3300053094 | Bacteria | 7021 |
| 207 | Ga0500628_000032 | 3300053129 | Bacteria | 52752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0233430 | Ga0316574_0233430_582_1019 | 135 |
| 2 | 3300036647 | Ga0316582_0093802 | Ga0316582_0093802_1175_1615 | 138 |
| 3 | 3300048919 | Ga0496116_0000598 | Ga0496116_0000598_20279_20710 | 140 |
| 4 | 3300048921 | Ga0496118_0116719 | Ga0496118_0116719_949_1380 | 140 |
| 5 | 3300048922 | Ga0496119_0000489 | Ga0496119_0000489_27140_27571 | 140 |
| 6 | 3300048923 | Ga0496120_0526391 | Ga0496120_0526391_23_454 | 140 |
| 7 | 3300005718 | Ga0068866_10009256 | Ga0068866_100092566 | 141 |
| 8 | 3300005614 | Ga0068856_100000064 | Ga0068856_10000006427 | 142 |
| 9 | 3300026078 | Ga0207702_10000016 | Ga0207702_1000001654 | 142 |
| 10 | 3300047317 | Ga0495604_0006256 | Ga0495604_0006256_7263_7694 | 142 |
| 11 | 3300048088 | Ga0495602_0000032 | Ga0495602_0000032_17616_18047 | 142 |
| 12 | 3300053084 | Ga0495595_0009491 | Ga0495595_0009491_512_943 | 142 |
| 13 | 3300005344 | Ga0070661_100000005 | Ga0070661_100000005160 | 143 |
| 14 | 3300005365 | Ga0070688_100001024 | Ga0070688_1000010244 | 143 |
| 15 | 3300005365 | Ga0070688_100002028 | Ga0070688_10000202810 | 143 |
| 16 | 3300005435 | Ga0070714_100037310 | Ga0070714_1000373105 | 143 |
| 17 | 3300005466 | Ga0070685_10002756 | Ga0070685_100027568 | 143 |
| 18 | 3300005466 | Ga0070685_10007157 | Ga0070685_100071574 | 143 |
| 19 | 3300005548 | Ga0070665_100226266 | Ga0070665_1002262662 | 143 |
| 20 | 3300005937 | Ga0081455_10004125 | Ga0081455_1000412515 | 143 |
| 21 | 3300006881 | Ga0068865_100000017 | Ga0068865_10000001758 | 143 |
| 22 | 3300009176 | Ga0105242_10001190 | Ga0105242_1000119021 | 143 |
| 23 | 3300009176 | Ga0105242_10003454 | Ga0105242_100034544 | 143 |
| 24 | 3300013100 | Ga0157373_10767574 | Ga0157373_107675742 | 143 |
| 25 | 3300014745 | Ga0157377_10241413 | Ga0157377_102414132 | 143 |
| 26 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005303 | 143 |
| 27 | 3300025929 | Ga0207664_10010061 | Ga0207664_100100614 | 143 |
| 28 | 3300025934 | Ga0207686_10000032 | Ga0207686_1000003259 | 143 |
| 29 | 3300025934 | Ga0207686_10000694 | Ga0207686_1000069414 | 143 |
| 30 | 3300025938 | Ga0207704_10000025 | Ga0207704_1000002549 | 143 |
| 31 | 3300025938 | Ga0207704_10097778 | Ga0207704_100977782 | 143 |
| 32 | 3300028379 | Ga0268266_10162217 | Ga0268266_101622173 | 143 |
| 33 | 3300041512 | Ga0451853_0120117 | Ga0451853_0120117_1247_1684 | 143 |
| 34 | 3300046459 | Ga0495629_0137263 | Ga0495629_0137263_1196_1633 | 143 |
| 35 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_76305_76742 | 143 |
| 36 | 3300046536 | Ga0495587_0113741 | Ga0495587_0113741_1013_1450 | 143 |
| 37 | 3300046678 | Ga0495599_0100405 | Ga0495599_0100405_1096_1533 | 143 |
| 38 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_573782_574213 | 143 |
| 39 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_753966_754397 | 143 |
| 40 | 3300048922 | Ga0496119_0081176 | Ga0496119_0081176_726_1157 | 143 |
| 41 | 3300049592 | Ga0501076_0346642 | Ga0501076_0346642_21_458 | 143 |
| 42 | 3300053077 | Ga0495601_0126151 | Ga0495601_0126151_789_1226 | 143 |
| 43 | 3300053094 | Ga0500566_0006347 | Ga0500566_0006347_792_1229 | 143 |
| 44 | 3300003659 | JGI25404J52841_10007520 | JGI25404J52841_100075204 | 144 |
| 45 | 3300005329 | Ga0070683_100140708 | Ga0070683_1001407083 | 144 |
| 46 | 3300005337 | Ga0070682_100000080 | Ga0070682_1000000808 | 144 |
| 47 | 3300005338 | Ga0068868_100002073 | Ga0068868_10000207314 | 144 |
| 48 | 3300005340 | Ga0070689_100108658 | Ga0070689_1001086582 | 144 |
| 49 | 3300005345 | Ga0070692_10062030 | Ga0070692_100620302 | 144 |
| 50 | 3300005347 | Ga0070668_100100874 | Ga0070668_1001008743 | 144 |
| 51 | 3300005356 | Ga0070674_100000004 | Ga0070674_10000000419 | 144 |
| 52 | 3300005364 | Ga0070673_100020828 | Ga0070673_1000208282 | 144 |
| 53 | 3300005367 | Ga0070667_100751172 | Ga0070667_1007511722 | 144 |
| 54 | 3300005435 | Ga0070714_100122939 | Ga0070714_1001229393 | 144 |
| 55 | 3300005436 | Ga0070713_100000760 | Ga0070713_10000076015 | 144 |
| 56 | 3300005436 | Ga0070713_100058581 | Ga0070713_1000585814 | 144 |
| 57 | 3300005439 | Ga0070711_101065568 | Ga0070711_1010655681 | 144 |
| 58 | 3300005439 | Ga0070711_101487798 | Ga0070711_1014877981 | 144 |
| 59 | 3300005441 | Ga0070700_101668874 | Ga0070700_1016688741 | 144 |
| 60 | 3300005455 | Ga0070663_100974184 | Ga0070663_1009741842 | 144 |
| 61 | 3300005459 | Ga0068867_100000556 | Ga0068867_10000055624 | 144 |
| 62 | 3300005535 | Ga0070684_100214142 | Ga0070684_1002141422 | 144 |
| 63 | 3300005539 | Ga0068853_100096319 | Ga0068853_1000963194 | 144 |
| 64 | 3300005548 | Ga0070665_100000655 | Ga0070665_1000006553 | 144 |
| 65 | 3300005548 | Ga0070665_100869155 | Ga0070665_1008691552 | 144 |
| 66 | 3300005577 | Ga0068857_100234760 | Ga0068857_1002347603 | 144 |
| 67 | 3300005578 | Ga0068854_100000212 | Ga0068854_10000021234 | 144 |
| 68 | 3300005614 | Ga0068856_100005082 | Ga0068856_1000050826 | 144 |
| 69 | 3300005616 | Ga0068852_100090219 | Ga0068852_1000902194 | 144 |
| 70 | 3300005617 | Ga0068859_102091891 | Ga0068859_1020918912 | 144 |
| 71 | 3300005718 | Ga0068866_10000004 | Ga0068866_1000000456 | 144 |
| 72 | 3300005834 | Ga0068851_10003103 | Ga0068851_100031038 | 144 |
| 73 | 3300005834 | Ga0068851_10016107 | Ga0068851_100161073 | 144 |
| 74 | 3300005841 | Ga0068863_100060697 | Ga0068863_1000606975 | 144 |
| 75 | 3300005843 | Ga0068860_100024464 | Ga0068860_1000244645 | 144 |
| 76 | 3300005844 | Ga0068862_102129273 | Ga0068862_1021292731 | 144 |
| 77 | 3300005983 | Ga0081540_1000006 | Ga0081540_10000065 | 144 |
| 78 | 3300006163 | Ga0070715_10000014 | Ga0070715_1000001415 | 144 |
| 79 | 3300006175 | Ga0070712_100013592 | Ga0070712_1000135928 | 144 |
| 80 | 3300009098 | Ga0105245_10066677 | Ga0105245_100666773 | 144 |
| 81 | 3300009101 | Ga0105247_10000105 | Ga0105247_100001058 | 144 |
| 82 | 3300009101 | Ga0105247_10077589 | Ga0105247_100775892 | 144 |
| 83 | 3300009174 | Ga0105241_10122101 | Ga0105241_101221012 | 144 |
| 84 | 3300009553 | Ga0105249_10550248 | Ga0105249_105502483 | 144 |
| 85 | 3300010375 | Ga0105239_10090147 | Ga0105239_100901473 | 144 |
| 86 | 3300013102 | Ga0157371_10064038 | Ga0157371_100640382 | 144 |
| 87 | 3300013297 | Ga0157378_10011430 | Ga0157378_100114306 | 144 |
| 88 | 3300013307 | Ga0157372_10025229 | Ga0157372_100252292 | 144 |
| 89 | 3300014326 | Ga0157380_10000028 | Ga0157380_1000002871 | 144 |
| 90 | 3300014968 | Ga0157379_10105022 | Ga0157379_101050223 | 144 |
| 91 | 3300020070 | Ga0206356_11075605 | Ga0206356_110756054 | 144 |
| 92 | 3300020070 | Ga0206356_11133739 | Ga0206356_111337391 | 144 |
| 93 | 3300022467 | Ga0224712_10066922 | Ga0224712_100669223 | 144 |
| 94 | 3300025321 | Ga0207656_10000169 | Ga0207656_100001692 | 144 |
| 95 | 3300025321 | Ga0207656_10009510 | Ga0207656_100095103 | 144 |
| 96 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005151 | 144 |
| 97 | 3300025900 | Ga0207710_10001368 | Ga0207710_100013686 | 144 |
| 98 | 3300025903 | Ga0207680_10001540 | Ga0207680_1000154011 | 144 |
| 99 | 3300025905 | Ga0207685_10000046 | Ga0207685_1000004614 | 144 |
| 100 | 3300025911 | Ga0207654_10080860 | Ga0207654_100808602 | 144 |
| 101 | 3300025915 | Ga0207693_10000853 | Ga0207693_1000085328 | 144 |
| 102 | 3300025916 | Ga0207663_10170015 | Ga0207663_101700153 | 144 |
| 103 | 3300025923 | Ga0207681_10063039 | Ga0207681_100630393 | 144 |
| 104 | 3300025927 | Ga0207687_10000007 | Ga0207687_1000000765 | 144 |
| 105 | 3300025927 | Ga0207687_10021449 | Ga0207687_100214494 | 144 |
| 106 | 3300025928 | Ga0207700_10000008 | Ga0207700_10000008284 | 144 |
| 107 | 3300025928 | Ga0207700_10000016 | Ga0207700_1000001663 | 144 |
| 108 | 3300025928 | Ga0207700_10042818 | Ga0207700_100428184 | 144 |
| 109 | 3300025936 | Ga0207670_10033738 | Ga0207670_100337383 | 144 |
| 110 | 3300025937 | Ga0207669_10000021 | Ga0207669_1000002176 | 144 |
| 111 | 3300025944 | Ga0207661_10000164 | Ga0207661_1000016431 | 144 |
| 112 | 3300025960 | Ga0207651_10001129 | Ga0207651_100011293 | 144 |
| 113 | 3300025961 | Ga0207712_10728685 | Ga0207712_107286852 | 144 |
| 114 | 3300025972 | Ga0207668_11807410 | Ga0207668_118074101 | 144 |
| 115 | 3300025981 | Ga0207640_10000137 | Ga0207640_100001379 | 144 |
| 116 | 3300025986 | Ga0207658_10410430 | Ga0207658_104104302 | 144 |
| 117 | 3300026023 | Ga0207677_10000914 | Ga0207677_100009144 | 144 |
| 118 | 3300026041 | Ga0207639_10069377 | Ga0207639_100693774 | 144 |
| 119 | 3300026067 | Ga0207678_10989526 | Ga0207678_109895261 | 144 |
| 120 | 3300026078 | Ga0207702_10003712 | Ga0207702_1000371210 | 144 |
| 121 | 3300026088 | Ga0207641_10049209 | Ga0207641_100492095 | 144 |
| 122 | 3300026089 | Ga0207648_10001621 | Ga0207648_100016216 | 144 |
| 123 | 3300026116 | Ga0207674_10083900 | Ga0207674_100839005 | 144 |
| 124 | 3300026121 | Ga0207683_10098099 | Ga0207683_100980995 | 144 |
| 125 | 3300026142 | Ga0207698_10059585 | Ga0207698_100595852 | 144 |
| 126 | 3300026142 | Ga0207698_10921338 | Ga0207698_109213382 | 144 |
| 127 | 3300028379 | Ga0268266_10000789 | Ga0268266_1000078920 | 144 |
| 128 | 3300028379 | Ga0268266_10419304 | Ga0268266_104193041 | 144 |
| 129 | 3300028381 | Ga0268264_10017636 | Ga0268264_100176363 | 144 |
| 130 | 3300028381 | Ga0268264_10916325 | Ga0268264_109163252 | 144 |
| 131 | 3300028666 | Ga0265336_10225304 | Ga0265336_102253041 | 144 |
| 132 | 3300044694 | Ga0466963_0115624 | Ga0466963_0115624_61_501 | 144 |
| 133 | 3300046459 | Ga0495629_0001755 | Ga0495629_0001755_3395_3832 | 144 |
| 134 | 3300046459 | Ga0495629_0031026 | Ga0495629_0031026_249_773 | 144 |
| 135 | 3300046461 | Ga0495641_0081327 | Ga0495641_0081327_518_952 | 144 |
| 136 | 3300046476 | Ga0495662_0003962 | Ga0495662_0003962_3456_3890 | 144 |
| 137 | 3300046476 | Ga0495662_0018860 | Ga0495662_0018860_1571_2014 | 144 |
| 138 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_3152_3589 | 144 |
| 139 | 3300046511 | Ga0495608_0000208 | Ga0495608_0000208_40014_40451 | 144 |
| 140 | 3300046517 | Ga0495630_0000025 | Ga0495630_0000025_47060_47494 | 144 |
| 141 | 3300046517 | Ga0495630_0115523 | Ga0495630_0115523_1192_1635 | 144 |
| 142 | 3300046520 | Ga0495637_0193719 | Ga0495637_0193719_275_712 | 144 |
| 143 | 3300046533 | Ga0495640_0110762 | Ga0495640_0110762_1055_1498 | 144 |
| 144 | 3300046536 | Ga0495587_0009402 | Ga0495587_0009402_2041_2523 | 144 |
| 145 | 3300046539 | Ga0495621_0052502 | Ga0495621_0052502_672_1118 | 144 |
| 146 | 3300046674 | Ga0495588_0000852 | Ga0495588_0000852_9311_9748 | 144 |
| 147 | 3300046675 | Ga0495657_0000406 | Ga0495657_0000406_1825_2262 | 144 |
| 148 | 3300046681 | Ga0495647_0002122 | Ga0495647_0002122_2661_3095 | 144 |
| 149 | 3300046683 | Ga0495658_0000696 | Ga0495658_0000696_4846_5286 | 144 |
| 150 | 3300046690 | Ga0495624_0000241 | Ga0495624_0000241_3400_3834 | 144 |
| 151 | 3300047317 | Ga0495604_0000013 | Ga0495604_0000013_186531_186968 | 144 |
| 152 | 3300047319 | Ga0495674_0000020 | Ga0495674_0000020_149244_149687 | 144 |
| 153 | 3300047320 | Ga0495672_0470172 | Ga0495672_0470172_56_502 | 144 |
| 154 | 3300047321 | Ga0495676_0005500 | Ga0495676_0005500_9871_10311 | 144 |
| 155 | 3300047321 | Ga0495676_0011278 | Ga0495676_0011278_7213_7656 | 144 |
| 156 | 3300047321 | Ga0495676_0545208 | Ga0495676_0545208_306_740 | 144 |
| 157 | 3300047322 | Ga0495680_0347339 | Ga0495680_0347339_473_916 | 144 |
| 158 | 3300047444 | Ga0495675_0000767 | Ga0495675_0000767_17009_17446 | 144 |
| 159 | 3300047444 | Ga0495675_0142252 | Ga0495675_0142252_607_1050 | 144 |
| 160 | 3300047472 | Ga0495686_0062178 | Ga0495686_0062178_966_1409 | 144 |
| 161 | 3300048903 | Ga0496100_0000049 | Ga0496100_0000049_42681_43121 | 144 |
| 162 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_57439_57879 | 144 |
| 163 | 3300048905 | Ga0496102_0001529 | Ga0496102_0001529_110_550 | 144 |
| 164 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_147677_148117 | 144 |
| 165 | 3300048907 | Ga0496104_0266300 | Ga0496104_0266300_996_1433 | 144 |
| 166 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_15400_15840 | 144 |
| 167 | 3300048910 | Ga0496107_0000032 | Ga0496107_0000032_42018_42458 | 144 |
| 168 | 3300048911 | Ga0496108_0027526 | Ga0496108_0027526_3443_3880 | 144 |
| 169 | 3300048912 | Ga0496109_0000252 | Ga0496109_0000252_31743_32180 | 144 |
| 170 | 3300048912 | Ga0496109_0192442 | Ga0496109_0192442_1438_1872 | 144 |
| 171 | 3300048913 | Ga0496110_0002687 | Ga0496110_0002687_5366_5803 | 144 |
| 172 | 3300048914 | Ga0496111_0000492 | Ga0496111_0000492_7643_8080 | 144 |
| 173 | 3300048914 | Ga0496111_1104356 | Ga0496111_1104356_78_515 | 144 |
| 174 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_213377_213817 | 144 |
| 175 | 3300048915 | Ga0496112_0093360 | Ga0496112_0093360_1095_1529 | 144 |
| 176 | 3300048916 | Ga0496113_0000411 | Ga0496113_0000411_16750_17184 | 144 |
| 177 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_209182_209622 | 144 |
| 178 | 3300048918 | Ga0496115_0000036 | Ga0496115_0000036_60146_60586 | 144 |
| 179 | 3300048921 | Ga0496118_0538787 | Ga0496118_0538787_34_474 | 144 |
| 180 | 3300049586 | Ga0501070_0003994 | Ga0501070_0003994_10704_11153 | 144 |
| 181 | 3300049586 | Ga0501070_0012329 | Ga0501070_0012329_3081_3521 | 144 |
| 182 | 3300053077 | Ga0495601_0643619 | Ga0495601_0643619_199_639 | 144 |
| 183 | 3300053078 | Ga0495612_0006476 | Ga0495612_0006476_1734_2171 | 144 |
| 184 | 3300053083 | Ga0495655_0000011 | Ga0495655_0000011_10714_11154 | 144 |
| 185 | 3300053083 | Ga0495655_0001994 | Ga0495655_0001994_1144_1581 | 144 |
| 186 | 3300053084 | Ga0495595_0000091 | Ga0495595_0000091_1825_2262 | 144 |
| 187 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_76116_76553 | 144 |
| 188 | 3300053085 | Ga0495619_0000141 | Ga0495619_0000141_15464_15901 | 144 |
| 189 | 3300053129 | Ga0500628_000032 | Ga0500628_000032_11519_11959 | 144 |
| 190 | 3300001979 | JGI24740J21852_10003599 | JGI24740J21852_100035998 | 145 |
| 191 | 3300005337 | Ga0070682_102070013 | Ga0070682_1020700131 | 145 |
| 192 | 3300009093 | Ga0105240_10494049 | Ga0105240_104940492 | 145 |
| 193 | 3300009545 | Ga0105237_10930970 | Ga0105237_109309702 | 145 |
| 194 | 3300010375 | Ga0105239_10191035 | Ga0105239_101910351 | 145 |
| 195 | 3300025913 | Ga0207695_10229934 | Ga0207695_102299343 | 145 |
| 196 | 3300025914 | Ga0207671_10101201 | Ga0207671_101012012 | 145 |
| 197 | 3300046455 | Ga0495603_0000002 | Ga0495603_0000002_35444_35890 | 145 |
| 198 | 3300047472 | Ga0495686_0196457 | Ga0495686_0196457_260_700 | 145 |
| 199 | 3300048907 | Ga0496104_0301850 | Ga0496104_0301850_550_990 | 145 |
| 200 | 3300048910 | Ga0496107_0435112 | Ga0496107_0435112_356_796 | 145 |
| 201 | 3300048922 | Ga0496119_0000710 | Ga0496119_0000710_2335_2775 | 145 |
| 202 | 3300048922 | Ga0496119_0046962 | Ga0496119_0046962_1543_1983 | 145 |
| 203 | 3300048924 | Ga0496121_0017521 | Ga0496121_0017521_417_857 | 145 |
| 204 | 3300048924 | Ga0496121_0158296 | Ga0496121_0158296_265_705 | 145 |
| 205 | 3300048924 | Ga0496121_0477975 | Ga0496121_0477975_17_457 | 145 |
| 206 | 3300048928 | Ga0496125_0298357 | Ga0496125_0298357_248_688 | 145 |
| 207 | 3300049822 | Ga0501035_0799937 | Ga0501035_0799937_261_704 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gs0-assembly2.cif.gz_L | crystal structure of the complex of tlr3 and bi-specific diabody | 0.61 | 38 | 59 |
| 3gs2-assembly1.cif.gz_A | ring1b c-terminal domain/cbx7 cbox complex | 0.6079 | 45 | 70 |
| 6gq8-assembly1.cif.gz_D | superoxide reductase from nanoarchaeum equitans | 0.595 | 39 | 60 |
| 5etl-assembly1.cif.gz_A | e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution | 0.5791 | 11 | 107 |
| 5hr4-assembly1.cif.gz_C | structure of type iil restriction-modification enzyme mmei in complex with dna has implications for engineering of new specificities | 0.5588 | 11 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zjvA04 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2; | 0.6182 | 45 | 63 | 2.20.28.290 |
| af_Q19585_99_334_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6017 | 39 | 58 | 3.40.50.300 |
| af_O17303_154_262_2.60.210.10 | Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | 0.5981 | 36 | 60 | 2.60.210.10 |
| 6gq8B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain | 0.5868 | 39 | 60 | 2.60.40.730 |
| af_Q5U334_33_148_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.5842 | 40 | 58 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1EDB8-F1-model_v4 | Putative hydrophobic protein (TIGR00271 family) | 0.8628 | 7 | 141 |
GO:0016020
|
| AF-A0A1H7MI81-F1-model_v4 | Uncharacterized protein | 0.8625 | 8 | 131 |
|
| AF-A0A3G4W275-F1-model_v4 | DUF1269 domain-containing protein | 0.861 | 7 | 143 |
|
| AF-A0A222TIR9-F1-model_v4 | deleted | 0.8582 | 7 | 143 |
|
| AF-A0A4R7HX69-F1-model_v4 | DUF1269 domain-containing protein | 0.858 | 1 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar