F316666

General Info

Members Datasets Scaffolds Average Seq Length
207 145 414 169

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_11460222|Ga0307405_114602221
Length 167
Sequence MPDYSAFIKRFELPEEFTAPTRLVHEDVVAQALTREHLDDDVRGINASLDLIRRTRGGGWPTEAVTEEFNYVDLVWHEQEFREGESFAYAVYGAGRYIGCCYLYPVGRRTPLSEALLANDVDVSWWVTPDAYERGYYAKLYRALQQWVAEEFPFRAPHYSNAAIPAD

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 2.9
Rhizosphere 90.82
Stem 0
Stem Tuber 0
Unclassified 18.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_11460222 3300031731 Bacteria 600
2 JGI25406J46586_10147476 3300003203 Bacteria 687
3 rootH2_10141261 3300003320 Bacteria 2539
4 Ga0065712_10450618 3300005290 Bacteria 661
5 Ga0070683_100479197 3300005329 Bacteria 1188
6 Ga0070670_100224214 3300005331 Bacteria 1636
7 Ga0068869_100821387 3300005334 Unclassified 800
8 Ga0068868_100117763 3300005338 Bacteria 2164
9 Ga0070689_100026319 3300005340 Unclassified 4379
10 Ga0070687_100151683 3300005343 Bacteria 1361
11 Ga0070668_100368457 3300005347 Bacteria 1220
12 Ga0070668_100433549 3300005347 Bacteria 1127
13 Ga0070669_100017691 3300005353 Bacteria 5085
14 Ga0070675_100028029 3300005354 Unclassified 4529
15 Ga0070675_101386411 3300005354 Bacteria 648
16 Ga0070671_100279185 3300005355 Bacteria 1420
17 Ga0070674_100757233 3300005356 Bacteria 835
18 Ga0070688_100026337 3300005365 Unclassified 3455
19 Ga0070667_100118211 3300005367 Bacteria 2304
20 Ga0070709_10086743 3300005434 Unclassified 2055
21 Ga0070714_100671119 3300005435 Bacteria 999
22 Ga0070713_100094616 3300005436 Unclassified 2576
23 Ga0070713_100118365 3300005436 Bacteria 2319
24 Ga0070713_100133626 3300005436 Unclassified 2190
25 Ga0070700_100737855 3300005441 Bacteria 787
26 Ga0068867_100448176 3300005459 Bacteria 1099
27 Ga0070706_100328208 3300005467 Bacteria 1427
28 Ga0070698_100009774 3300005471 Bacteria 10255
29 Ga0070698_100015356 3300005471 Bacteria 8093
30 Ga0070698_100164556 3300005471 Unclassified 2161
31 Ga0070672_100040660 3300005543 Unclassified 3569
32 Ga0070686_100050831 3300005544 Unclassified 2636
33 Ga0070665_100173499 3300005548 Bacteria 2157
34 Ga0070665_100916176 3300005548 Bacteria 889
35 Ga0070665_101212302 3300005548 Bacteria 765
36 Ga0068856_100571505 3300005614 Unclassified 1152
37 Ga0068859_100022108 3300005617 Bacteria 6376
38 Ga0068859_100810007 3300005617 Bacteria 1024
39 Ga0068861_100999311 3300005719 Unclassified 798
40 Ga0068870_10040452 3300005840 Bacteria 2417
41 Ga0068858_100698151 3300005842 Bacteria 987
42 Ga0068862_100159125 3300005844 Unclassified 2015
43 Ga0081455_10020480 3300005937 Bacteria 6224
44 Ga0081455_10081404 3300005937 Bacteria 2651
45 Ga0081538_10000532 3300005981 Bacteria 42046
46 Ga0081540_1112446 3300005983 Bacteria 1148
47 Ga0081539_10173708 3300005985 Bacteria 1016
48 Ga0070717_10088941 3300006028 Bacteria 2604
49 Ga0070717_10253038 3300006028 Bacteria 1556
50 Ga0070717_10455245 3300006028 Bacteria 1154
51 Ga0075365_10010038 3300006038 Bacteria 5489
52 Ga0070715_10045009 3300006163 Bacteria 1869
53 Ga0070715_10313599 3300006163 Bacteria 844
54 Ga0070716_100075536 3300006173 Bacteria 1994
55 Ga0070712_100247187 3300006175 Unclassified 1423
56 Ga0075428_100039284 3300006844 Bacteria 5207
57 Ga0075428_100255231 3300006844 Bacteria 1889
58 Ga0075430_100011722 3300006846 Bacteria 7462
59 Ga0075430_100070685 3300006846 Bacteria 2927
60 Ga0075431_100001528 3300006847 Bacteria 21441
61 Ga0075431_100004111 3300006847 Bacteria 14211
62 Ga0075431_100048343 3300006847 Bacteria 4387
63 Ga0075429_100028510 3300006880 Bacteria 4847
64 Ga0075429_100432328 3300006880 Bacteria 1153
65 Ga0075436_100521182 3300006914 Bacteria 871
66 Ga0097620_100022110 3300006931 Bacteria 6376
67 Ga0097620_100810046 3300006931 Bacteria 1024
68 Ga0099794_10020916 3300007265 Bacteria 2967
69 Ga0099794_10030005 3300007265 Unclassified 2536
70 Ga0099794_10075114 3300007265 Bacteria 1661
71 Ga0105245_10096789 3300009098 Bacteria 2724
72 Ga0114129_10213600 3300009147 Bacteria 2607
73 Ga0105243_10775769 3300009148 Bacteria 942
74 Ga0105248_10046491 3300009177 Bacteria 4865
75 Ga0105249_10324146 3300009553 Bacteria 1552
76 Ga0105239_10574632 3300010375 Bacteria 1285
77 Ga0105239_10715725 3300010375 Bacteria 1145
78 Ga0105246_10203867 3300011119 Bacteria 1539
79 Ga0105246_10242606 3300011119 Bacteria 1425
80 Ga0105246_10434630 3300011119 Bacteria 1099
81 Ga0157371_10132826 3300013102 Bacteria 1771
82 Ga0163162_11993696 3300013306 Bacteria 665
83 Ga0157372_10717921 3300013307 Bacteria 1163
84 Ga0157375_10083166 3300013308 Unclassified 3245
85 Ga0157375_10382732 3300013308 Bacteria 1574
86 Ga0163163_10298385 3300014325 Bacteria 1664
87 Ga0163163_10589515 3300014325 Bacteria 1175
88 Ga0157377_10144176 3300014745 Bacteria 1466
89 Ga0213876_10325264 3300021384 Unclassified 817
90 Ga0213875_10063030 3300021388 Bacteria 1733
91 Ga0213875_10136414 3300021388 Bacteria 1148
92 Ga0207692_10058550 3300025898 Bacteria 1985
93 Ga0207688_10496855 3300025901 Bacteria 764
94 Ga0207685_10020283 3300025905 Bacteria 2206
95 Ga0207699_10083350 3300025906 Unclassified 1989
96 Ga0207684_10096735 3300025910 Bacteria 2520
97 Ga0207693_10333422 3300025915 Bacteria 1188
98 Ga0207663_10046847 3300025916 Bacteria 2666
99 Ga0207662_10003308 3300025918 Bacteria 8270
100 Ga0207646_10217009 3300025922 Unclassified 1728
101 Ga0207681_10013048 3300025923 Bacteria 5137
102 Ga0207650_10522792 3300025925 Unclassified 993
103 Ga0207700_10252769 3300025928 Unclassified 1506
104 Ga0207700_10839144 3300025928 Unclassified 822
105 Ga0207664_10036423 3300025929 Bacteria 3803
106 Ga0207709_10306357 3300025935 Bacteria 1183
107 Ga0207665_10037545 3300025939 Bacteria 3225
108 Ga0207691_10051100 3300025940 Unclassified 3781
109 Ga0207661_11133135 3300025944 Bacteria 720
110 Ga0207712_10575692 3300025961 Bacteria 971
111 Ga0207712_10706879 3300025961 Bacteria 880
112 Ga0207668_10472678 3300025972 Bacteria 1074
113 Ga0207658_10114449 3300025986 Bacteria 2139
114 Ga0207677_10284126 3300026023 Bacteria 1360
115 Ga0207677_10596749 3300026023 Bacteria 969
116 Ga0207648_10171760 3300026089 Bacteria 1916
117 Ga0207648_11310849 3300026089 Bacteria 680
118 Ga0207676_10436191 3300026095 Bacteria 1232
119 Ga0207676_10962079 3300026095 Bacteria 840
120 Ga0207674_10636527 3300026116 Bacteria 1030
121 Ga0207675_100764050 3300026118 Bacteria 978
122 Ga0268266_10144865 3300028379 Bacteria 2135
123 Ga0268266_10763885 3300028379 Bacteria 933
124 Ga0268265_10386191 3300028380 Unclassified 1290
125 Ga0307405_11134929 3300031731 Bacteria 673
126 Ga0307413_10150429 3300031824 Bacteria 1621
127 Ga0307413_10514575 3300031824 Bacteria 964
128 Ga0307413_11302470 3300031824 Bacteria 636
129 Ga0307410_10185410 3300031852 Bacteria 1579
130 Ga0307406_11168081 3300031901 Bacteria 667
131 Ga0307412_10910471 3300031911 Bacteria 771
132 Ga0307409_101255085 3300031995 Bacteria 765
133 Ga0307416_100962774 3300032002 Bacteria 956
134 Ga0307416_101173556 3300032002 Bacteria 873
135 Ga0307414_10663125 3300032004 Bacteria 941
136 Ga0307411_11153494 3300032005 Bacteria 701
137 Ga0307415_100004999 3300032126 Bacteria 6980
138 Ga0307415_100384421 3300032126 Bacteria 1193
139 Ga0373929_0139749 3300035085 Archaea 642
140 Ga0373931_0126785 3300035691 Bacteria 1465
141 Ga0373937_0683493 3300036401 Bacteria 972
142 Ga0436364_0462954 3300037853 Bacteria 21686
143 Ga0436364_1127757 3300037853 Bacteria 43348
144 Ga0436365_0319643 3300039437 Bacteria 850
145 Ga0436365_1449334 3300039437 Bacteria 728
146 Ga0436363_0047956 3300039450 Bacteria 1342
147 Ga0436363_1625118 3300039450 Bacteria 2055
148 Ga0436362_0652203 3300039453 Bacteria 1901
149 Ga0466963_0048423 3300044694 Bacteria 2808
150 Ga0466963_0149827 3300044694 Bacteria 1619
151 Ga0466963_0364783 3300044694 Bacteria 1017
152 Ga0466968_0010729 3300044735 Bacteria 3559
153 Ga0466970_0150426 3300044765 Bacteria 1285
154 Ga0466960_0034033 3300044901 Bacteria 2372
155 Ga0466960_0060409 3300044901 Unclassified 1858
156 Ga0466960_0399681 3300044901 Unclassified 791
157 Ga0466967_0003888 3300045976 Bacteria 9909
158 Ga0495651_0023017 3300046462 Bacteria 4845
159 Ga0495651_0141010 3300046462 Bacteria 1748
160 Ga0495653_0196737 3300046463 Bacteria 1371
161 Ga0495653_0342344 3300046463 Unclassified 963
162 Ga0495582_0196314 3300046473 Bacteria 1152
163 Ga0495664_0019070 3300046477 Unclassified 3939
164 Ga0495664_0126701 3300046477 Bacteria 1545
165 Ga0495664_0421650 3300046477 Unclassified 800
166 Ga0495618_0123682 3300046514 Unclassified 1656
167 Ga0495652_0051892 3300046529 Bacteria 3500
168 Ga0495652_0265858 3300046529 Bacteria 1263
169 Ga0495667_0035778 3300046559 Bacteria 3317
170 Ga0495667_0106061 3300046559 Bacteria 1816
171 Ga0495634_0155979 3300046642 Bacteria 1441
172 Ga0495657_0049969 3300046675 Unclassified 2814
173 Ga0495599_0227636 3300046678 Bacteria 1139
174 Ga0495646_0150654 3300046680 Bacteria 1294
175 Ga0495646_0187982 3300046680 Bacteria 1130
176 Ga0495613_0350658 3300046689 Bacteria 1014
177 Ga0495624_0170724 3300046690 Bacteria 1327
178 Ga0495604_0101074 3300047317 Unclassified 2119
179 Ga0495604_0437335 3300047317 Unclassified 856
180 Ga0495674_0040960 3300047319 Bacteria 4140
181 Ga0495680_0027368 3300047322 Bacteria 4687
182 Ga0495680_0068739 3300047322 Unclassified 2705
183 Ga0495684_0014213 3300047471 Bacteria 6125
184 Ga0495684_0017781 3300047471 Bacteria 5476
185 Ga0495602_0008286 3300048088 Bacteria 10861
186 Ga0495602_0458864 3300048088 Unclassified 898
187 Ga0495602_1057503 3300048088 Unclassified 533
188 Ga0496102_0645023 3300048905 Bacteria 982
189 Ga0496104_0259953 3300048907 Bacteria 1649
190 Ga0496106_0994619 3300048909 Bacteria 660
191 Ga0496109_0254736 3300048912 Bacteria 1653
192 Ga0496110_1507708 3300048913 Bacteria 582
193 Ga0496113_0918362 3300048916 Bacteria 692
194 nmdc:mga0yw44_39133_c1 3300050492 Bacteria 2810
195 nmdc:mga05p37_134304_c1 3300050507 Bacteria 3036
196 nmdc:mga05p37_292750_c1 3300050507 Bacteria 1937
197 nmdc:mga09592_126095_c1 3300050508 Unclassified 2200
198 nmdc:mga0qj67_342601_c1 3300050509 Bacteria 1209
199 nmdc:mga0qj67_363919_c1 3300050509 Bacteria 1169
200 nmdc:mga0qj67_9056_c1 3300050509 Bacteria 7387
201 nmdc:mga06r32_14223_c1 3300050510 Bacteria 7218
202 nmdc:mga06r32_152266_c1 3300050510 Bacteria 2292
203 nmdc:mga06r32_263894_c1 3300050510 Bacteria 1710
204 nmdc:mga0a205_242175_c1 3300050515 Unclassified 1684
205 Ga0495595_0019226 3300053084 Bacteria 2963
206 Ga0500577_0004346 3300053142 Bacteria 3736
207 Ga0587062_001482 3300059639 Bacteria 2044
208 Ga0307405_11460222
209 JGI25406J46586_10147476
210 rootH2_10141261
211 Ga0065712_10450618
212 Ga0070683_100479197
213 Ga0070670_100224214
214 Ga0068869_100821387
215 Ga0068868_100117763
216 Ga0070689_100026319
217 Ga0070687_100151683
218 Ga0070668_100368457
219 Ga0070668_100433549
220 Ga0070669_100017691
221 Ga0070675_100028029
222 Ga0070675_101386411
223 Ga0070671_100279185
224 Ga0070674_100757233
225 Ga0070688_100026337
226 Ga0070667_100118211
227 Ga0070709_10086743
228 Ga0070714_100671119
229 Ga0070713_100094616
230 Ga0070713_100118365
231 Ga0070713_100133626
232 Ga0070700_100737855
233 Ga0068867_100448176
234 Ga0070706_100328208
235 Ga0070698_100009774
236 Ga0070698_100015356
237 Ga0070698_100164556
238 Ga0070672_100040660
239 Ga0070686_100050831
240 Ga0070665_100173499
241 Ga0070665_100916176
242 Ga0070665_101212302
243 Ga0068856_100571505
244 Ga0068859_100022108
245 Ga0068859_100810007
246 Ga0068861_100999311
247 Ga0068870_10040452
248 Ga0068858_100698151
249 Ga0068862_100159125
250 Ga0081455_10020480
251 Ga0081455_10081404
252 Ga0081538_10000532
253 Ga0081540_1112446
254 Ga0081539_10173708
255 Ga0070717_10088941
256 Ga0070717_10253038
257 Ga0070717_10455245
258 Ga0075365_10010038
259 Ga0070715_10045009
260 Ga0070715_10313599
261 Ga0070716_100075536
262 Ga0070712_100247187
263 Ga0075428_100039284
264 Ga0075428_100255231
265 Ga0075430_100011722
266 Ga0075430_100070685
267 Ga0075431_100001528
268 Ga0075431_100004111
269 Ga0075431_100048343
270 Ga0075429_100028510
271 Ga0075429_100432328
272 Ga0075436_100521182
273 Ga0097620_100022110
274 Ga0097620_100810046
275 Ga0099794_10020916
276 Ga0099794_10030005
277 Ga0099794_10075114
278 Ga0105245_10096789
279 Ga0114129_10213600
280 Ga0105243_10775769
281 Ga0105248_10046491
282 Ga0105249_10324146
283 Ga0105239_10574632
284 Ga0105239_10715725
285 Ga0105246_10203867
286 Ga0105246_10242606
287 Ga0105246_10434630
288 Ga0157371_10132826
289 Ga0163162_11993696
290 Ga0157372_10717921
291 Ga0157375_10083166
292 Ga0157375_10382732
293 Ga0163163_10298385
294 Ga0163163_10589515
295 Ga0157377_10144176
296 Ga0213876_10325264
297 Ga0213875_10063030
298 Ga0213875_10136414
299 Ga0207692_10058550
300 Ga0207688_10496855
301 Ga0207685_10020283
302 Ga0207699_10083350
303 Ga0207684_10096735
304 Ga0207693_10333422
305 Ga0207663_10046847
306 Ga0207662_10003308
307 Ga0207646_10217009
308 Ga0207681_10013048
309 Ga0207650_10522792
310 Ga0207700_10252769
311 Ga0207700_10839144
312 Ga0207664_10036423
313 Ga0207709_10306357
314 Ga0207665_10037545
315 Ga0207691_10051100
316 Ga0207661_11133135
317 Ga0207712_10575692
318 Ga0207712_10706879
319 Ga0207668_10472678
320 Ga0207658_10114449
321 Ga0207677_10284126
322 Ga0207677_10596749
323 Ga0207648_10171760
324 Ga0207648_11310849
325 Ga0207676_10436191
326 Ga0207676_10962079
327 Ga0207674_10636527
328 Ga0207675_100764050
329 Ga0268266_10144865
330 Ga0268266_10763885
331 Ga0268265_10386191
332 Ga0307405_11134929
333 Ga0307413_10150429
334 Ga0307413_10514575
335 Ga0307413_11302470
336 Ga0307410_10185410
337 Ga0307406_11168081
338 Ga0307412_10910471
339 Ga0307409_101255085
340 Ga0307416_100962774
341 Ga0307416_101173556
342 Ga0307414_10663125
343 Ga0307411_11153494
344 Ga0307415_100004999
345 Ga0307415_100384421
346 Ga0373929_0139749
347 Ga0373931_0126785
348 Ga0373937_0683493
349 Ga0436364_0462954
350 Ga0436364_1127757
351 Ga0436365_0319643
352 Ga0436365_1449334
353 Ga0436363_0047956
354 Ga0436363_1625118
355 Ga0436362_0652203
356 Ga0466963_0048423
357 Ga0466963_0149827
358 Ga0466963_0364783
359 Ga0466968_0010729
360 Ga0466970_0150426
361 Ga0466960_0034033
362 Ga0466960_0060409
363 Ga0466960_0399681
364 Ga0466967_0003888
365 Ga0495651_0023017
366 Ga0495651_0141010
367 Ga0495653_0196737
368 Ga0495653_0342344
369 Ga0495582_0196314
370 Ga0495664_0019070
371 Ga0495664_0126701
372 Ga0495664_0421650
373 Ga0495618_0123682
374 Ga0495652_0051892
375 Ga0495652_0265858
376 Ga0495667_0035778
377 Ga0495667_0106061
378 Ga0495634_0155979
379 Ga0495657_0049969
380 Ga0495599_0227636
381 Ga0495646_0150654
382 Ga0495646_0187982
383 Ga0495613_0350658
384 Ga0495624_0170724
385 Ga0495604_0101074
386 Ga0495604_0437335
387 Ga0495674_0040960
388 Ga0495680_0027368
389 Ga0495680_0068739
390 Ga0495684_0014213
391 Ga0495684_0017781
392 Ga0495602_0008286
393 Ga0495602_0458864
394 Ga0495602_1057503
395 Ga0496102_0645023
396 Ga0496104_0259953
397 Ga0496106_0994619
398 Ga0496109_0254736
399 Ga0496110_1507708
400 Ga0496113_0918362
401 nmdc:mga0yw44_39133_c1
402 nmdc:mga05p37_134304_c1
403 nmdc:mga05p37_292750_c1
404 nmdc:mga09592_126095_c1
405 nmdc:mga0qj67_342601_c1
406 nmdc:mga0qj67_363919_c1
407 nmdc:mga0qj67_9056_c1
408 nmdc:mga06r32_14223_c1
409 nmdc:mga06r32_152266_c1
410 nmdc:mga06r32_263894_c1
411 nmdc:mga0a205_242175_c1
412 Ga0495595_0019226
413 Ga0500577_0004346
414 Ga0587062_001482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

28

164

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.7912 24 152
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.7901 21 151
2fck-assembly1.cif.gz_A-2 structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae. 0.7758 16 147
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.7671 17 152
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.7595 19 148
ID Description Score Start End Superfamily
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8358 24 151 3.40.630.30
af_O05841_12_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8353 26 150 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8152 22 157 3.40.630.30
1z9uA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7912 24 152 3.40.630.30
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7877 20 150 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A512D0K5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9962 1 165
AF-A0A4U5K2T6-F1-model_v4 GNAT family N-acetyltransferase 0.9951 1 166 GO:0016747
AF-A0A4U5K2T6-F1-model_v4 GNAT family N-acetyltransferase 0.9892 1 166 GO:0016747
AF-A0A177BVZ6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9803 8 166
AF-A0A512D0K5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9784 1 165

Map