F316617

General Info

Members Datasets Scaffolds Average Seq Length
207 161 415 127

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_11654068|Ga0268266_116540682
Length 138
Sequence MDTFPDGGWFTMSANTERYETAVARYFEAWNAGEPEALAKAVAAAWATDGTYTDPLAAVSGHEEIAALITAAHGQFPGFAFRLTGAVDGHHDTARFSWELVSEADGSAPVAGFDVITLDADGRIRSVLGFLDRVPAGA

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
126 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
129 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
131 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
132 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
133 2643221647 Streptomyces sp. Root369 Isolate Unclassified
134 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
135 2643221714 Streptomyces sp. Root264 Isolate Unclassified
136 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
137 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
138 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
139 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
140 2808606448 Streptomyces sp. 193411 Isolate Unclassified
141 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
142 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
143 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
144 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
145 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
146 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
147 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
148 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
149 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
150 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
151 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
152 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
153 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
154 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
155 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
156 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
157 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
158 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
159 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
160 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
161 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.02
Metatranscriptomes 0
Isolates 14.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.63
Nodule 0.48
Rhizoplane 0.97
Rhizosphere 65.7
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_11654068 3300028379 Bacteria 616
2 JGI24739J22299_10016575 3300001989 Bacteria 2666
3 JGI24737J22298_10019507 3300001990 Bacteria 2169
4 JGI24735J21928_10068414 3300002067 Bacteria 1018
5 JGI24738J21930_10021621 3300002075 Bacteria 1333
6 rootH1_10002067 3300003316 Bacteria 3896
7 rootH1_10002067 3300003323 Bacteria 25565
8 rootH1_10065922 3300003316 Bacteria 1660
9 rootH1_10119457 3300003316 Bacteria 1413
10 rootH2_10106675 3300003320 Bacteria 1621
11 rootL2_10012589 3300003322 Bacteria 2174
12 rootL2_10080836 3300003322 Bacteria 2673
13 rootL2_10206566 3300003322 Bacteria 1612
14 rootH1_10003684 3300003323 Bacteria 2373
15 rootH1_10033400 3300003323 Bacteria 1920
16 Ga0070714_100065526 3300005435 Bacteria 3129
17 Ga0068855_100307474 3300005563 Bacteria 1754
18 Ga0070664_100687958 3300005564 Bacteria 952
19 Ga0068854_100543561 3300005578 Bacteria 984
20 Ga0068856_100503836 3300005614 Bacteria 1232
21 Ga0068856_101741242 3300005614 Unclassified 635
22 Ga0068861_100131459 3300005719 Bacteria 2032
23 Ga0081455_10179510 3300005937 Bacteria 1604
24 Ga0081455_10264432 3300005937 Bacteria 1251
25 Ga0075365_10508919 3300006038 Bacteria 851
26 Ga0075368_10063368 3300006042 Bacteria 1483
27 Ga0070715_10018481 3300006163 Bacteria 2657
28 Ga0075367_10000756 3300006178 Bacteria 12614
29 Ga0075370_10033554 3300006353 Bacteria 2875
30 Ga0075370_10240475 3300006353 Bacteria 1072
31 Ga0099826_10042232 3300006948 Bacteria 3155
32 Ga0105245_11543190 3300009098 Bacteria 715
33 Ga0105243_10287747 3300009148 Bacteria 1483
34 Ga0105238_10573706 3300009551 Bacteria 1134
35 Ga0105246_10400381 3300011119 Bacteria 1140
36 Ga0157369_10895362 3300013105 Bacteria 910
37 Ga0157374_10565129 3300013296 Bacteria 1146
38 Ga0163162_10052176 3300013306 Bacteria 4107
39 Ga0157372_10342334 3300013307 Bacteria 1742
40 Ga0163163_10904085 3300014325 Bacteria 946
41 Ga0182008_10005993 3300014497 Bacteria 6843
42 Ga0182007_10002837 3300015262 Bacteria 8431
43 Ga0209758_1003155 3300025297 Bacteria 15485
44 Ga0207426_1102680 3300025302 Bacteria 735
45 Ga0207647_10038136 3300025904 Bacteria 3040
46 Ga0207685_10804790 3300025905 Bacteria 518
47 Ga0207663_11397001 3300025916 Unclassified 564
48 Ga0207687_11258242 3300025927 Bacteria 636
49 Ga0207709_10057872 3300025935 Bacteria 2406
50 Ga0207679_11470756 3300025945 Unclassified 625
51 Ga0207640_10618095 3300025981 Bacteria 919
52 Ga0209813_10000650 3300027866 Bacteria 7976
53 Ga0207428_11164462 3300027907 Unclassified 537
54 Ga0307511_10000047 3300030521 Bacteria 98863
55 Ga0307511_10035952 3300030521 Bacteria 4314
56 Ga0307511_10059488 3300030521 Bacteria 2938
57 Ga0307512_10008193 3300030522 Bacteria 10219
58 Ga0307513_10067161 3300031456 Bacteria 3764
59 Ga0307509_10016941 3300031507 Bacteria 8404
60 Ga0307509_10036159 3300031507 Bacteria 5411
61 Ga0307509_10055491 3300031507 Bacteria 4210
62 Ga0307509_10618181 3300031507 Bacteria 755
63 Ga0307508_10542085 3300031616 Bacteria 761
64 Ga0307514_10005418 3300031649 Bacteria 11402
65 Ga0307514_10051181 3300031649 Bacteria 3202
66 Ga0307516_10000711 3300031730 Bacteria 45216
67 Ga0307516_10169756 3300031730 Bacteria 1923
68 Ga0307516_10297099 3300031730 Bacteria 1292
69 Ga0307518_10103577 3300031838 Bacteria 2034
70 Ga0307518_10378655 3300031838 Bacteria 804
71 Ga0307507_10119956 3300033179 Bacteria 2108
72 Ga0307507_10139807 3300033179 Bacteria 1861
73 Ga0307507_10430497 3300033179 Bacteria 737
74 Ga0307510_10030278 3300033180 Bacteria 6136
75 Ga0307510_10045511 3300033180 Bacteria 4736
76 Ga0307510_10051029 3300033180 Bacteria 4379
77 Ga0395899_0162146 3300037312 Bacteria 1579
78 Ga0395899_0927048 3300037312 Unclassified 529
79 Ga0395900_0284150 3300037418 Bacteria 1645
80 Ga0395900_0402938 3300037418 Bacteria 1332
81 Ga0395900_1086617 3300037418 Bacteria 717
82 Ga0395898_0006955 3300037466 Bacteria 12022
83 Ga0395898_0076671 3300037466 Bacteria 3228
84 Ga0395898_0500601 3300037466 Bacteria 1155
85 Ga0439439_0015530 3300041406 Bacteria 1861
86 Ga0451853_0046932 3300041512 Bacteria 3137
87 Ga0451853_0666630 3300041512 Bacteria 4729
88 Ga0451853_0839500 3300041512 Bacteria 669
89 Ga0439457_024178 3300042014 Bacteria 1344
90 Ga0450894_000046 3300042131 Bacteria 18159
91 Ga0450898_002764 3300042134 Bacteria 2463
92 Ga0450899_001518 3300042135 Bacteria 2580
93 Ga0450906_000417 3300042145 Bacteria 8784
94 Ga0466969_0020886 3300044656 Bacteria 3387
95 Ga0466972_0000851 3300044658 Bacteria 14629
96 Ga0466972_0055434 3300044658 Bacteria 1906
97 Ga0466972_0130794 3300044658 Bacteria 1182
98 Ga0466972_0342140 3300044658 Bacteria 699
99 Ga0466965_0005719 3300044683 Bacteria 5607
100 Ga0466965_0010295 3300044683 Bacteria 4358
101 Ga0466965_0081909 3300044683 Bacteria 1632
102 Ga0466966_0024286 3300044684 Bacteria 3965
103 Ga0466961_0017761 3300044693 Bacteria 4570
104 Ga0466961_0505484 3300044693 Bacteria 730
105 Ga0466963_0000279 3300044694 Bacteria 22827
106 Ga0466964_0011874 3300044706 Bacteria 3293
107 Ga0466964_0226424 3300044706 Bacteria 910
108 Ga0466970_0001245 3300044765 Bacteria 12348
109 Ga0466970_0002248 3300044765 Bacteria 9322
110 Ga0466957_0000404 3300044842 Bacteria 21092
111 Ga0466960_0003652 3300044901 Bacteria 5936
112 Ga0466960_0336531 3300044901 Bacteria 858
113 Ga0466959_0000297 3300045049 Bacteria 29628
114 Ga0466958_0030577 3300045836 Bacteria 3199
115 Ga0466967_0018653 3300045976 Bacteria 5553
116 Ga0466967_0069175 3300045976 Bacteria 3154
117 Ga0466967_1255583 3300045976 Bacteria 738
118 Ga0495629_0050995 3300046459 Bacteria 2896
119 Ga0495629_0055899 3300046459 Bacteria 2760
120 Ga0495651_0020897 3300046462 Bacteria 5082
121 Ga0495582_0185949 3300046473 Bacteria 1184
122 Ga0495662_0001234 3300046476 Bacteria 12592
123 Ga0495664_0000236 3300046477 Bacteria 26604
124 Ga0495618_0023081 3300046514 Bacteria 3844
125 Ga0495628_0090220 3300046516 Bacteria 2373
126 Ga0495630_0035370 3300046517 Bacteria 3733
127 Ga0495652_0023380 3300046529 Bacteria 5477
128 Ga0495640_0094570 3300046533 Bacteria 1968
129 Ga0495587_0053810 3300046536 Bacteria 2372
130 Ga0495645_0192290 3300046543 Bacteria 1390
131 Ga0495634_0003864 3300046642 Bacteria 11894
132 Ga0495625_0026266 3300046660 Bacteria 4403
133 Ga0495635_0061423 3300046663 Bacteria 2581
134 Ga0495599_0198440 3300046678 Bacteria 1233
135 Ga0495623_0251948 3300046679 Bacteria 992
136 Ga0495646_0000835 3300046680 Bacteria 17392
137 Ga0495613_0000319 3300046689 Bacteria 43656
138 Ga0495613_0702608 3300046689 Bacteria 665
139 Ga0495624_0663426 3300046690 Bacteria 620
140 Ga0495671_0415950 3300046692 Bacteria 643
141 Ga0495600_0021716 3300046809 Bacteria 4115
142 Ga0495581_0020514 3300047315 Bacteria 3835
143 Ga0495604_0006154 3300047317 Bacteria 9521
144 Ga0495636_0101942 3300047318 Bacteria 1256
145 Ga0495674_0724393 3300047319 Bacteria 779
146 Ga0495676_0016697 3300047321 Bacteria 6502
147 Ga0495687_013004 3300047443 Bacteria 4366
148 Ga0495687_030387 3300047443 Bacteria 2487
149 Ga0495685_002836 3300047447 Bacteria 5470
150 Ga0495686_0119594 3300047472 Bacteria 1572
151 Ga0495593_0008280 3300047673 Bacteria 6050
152 Ga0495602_0127088 3300048088 Bacteria 2040
153 Ga0495614_0014620 3300048089 Bacteria 3432
154 Ga0495615_0070499 3300048090 Bacteria 941
155 Ga0496102_0900523 3300048905 Bacteria 806
156 Ga0501033_0527176 3300049570 Bacteria 815
157 Ga0501034_0017466 3300049571 Bacteria 7358
158 Ga0501036_0006831 3300049572 Bacteria 9270
159 Ga0501047_0028610 3300049581 Bacteria 5374
160 Ga0501044_0455008 3300049823 Bacteria 1186
161 nmdc:mga06z11_1372_c1 3300050494 Bacteria 9014
162 nmdc:mga04h51_1187_c1 3300050495 Bacteria 6006
163 nmdc:mga07m45_132000_c1 3300050496 Bacteria 1445
164 nmdc:mga07m45_43776_c1 3300050496 Bacteria 2510
165 Ga0495619_0061198 3300053085 Bacteria 2505
166 Ga0500566_0001797 3300053094 Bacteria 12600
167 Ga0500641_0174457 3300053096 Bacteria 925
168 Ga0500650_0105680 3300053098 Bacteria 1316
169 Ga0500560_027730 3300053107 Bacteria 1684
170 Ga0500560_112605 3300053107 Bacteria 913
171 Ga0500572_013605 3300053111 Bacteria 2017
172 Ga0500559_0340744 3300053136 Bacteria 702
173 Ga0500573_0086248 3300053140 Bacteria 1779
174 Ga0500573_0435048 3300053140 Bacteria 611
175 Ga0500600_0055739 3300053149 Bacteria 2225
176 Ga0466962_0002489 3300061719 Bacteria 8730
177 Ga0466962_0396858 3300061719 Bacteria 690
178 2585306000 2582581313 Bacteria 10042643
179 2585316407 2582581314 Bacteria 11452267
180 2644265134 2643221647 Bacteria 10741251
181 2644441813 2643221678 Bacteria 9540101
182 2644630799 2643221714 Bacteria 9015452
183 2784586016 2784132148 Bacteria 8627943
184 2785366235 2784746768 Bacteria 10036182
185 2793978225 2791355406 Bacteria 11364898
186 2808917467 2808606375 Bacteria 9466072
187 2809229517 2808606448 Bacteria 8656184
188 2812477200 2811994917 Bacteria 7761064
189 2873319654 2873314349 Bacteria 8512634
190 2877684278 2877676314 Bacteria 9512378
191 2912726805 2912723979 Bacteria 8557534
192 2919473854 2919468124 Bacteria 9133025
193 2946073018 2946072368 Bacteria 8999607
194 2954389615 2954380949 Bacteria 10050426
195 2954700456 2954691527 Bacteria 10720516
196 2954701772 2954701450 Bacteria 10834262
197 2954719132 2954711539 Bacteria 10867210
198 2954729102 2954721474 Bacteria 10456478
199 2954732709 2954731030 Bacteria 10243860
200 2954748002 2954740390 Bacteria 10229294
201 2954751587 2954749733 Bacteria 10366972
202 2954767127 2954759201 Bacteria 9358192
203 2990088799 2990088156 Bacteria 6657676
204 2997457307 2997451912 Bacteria 8492419
205 8047895234 8047893842 Bacteria 11723082
206 8048363717 8048356638 Bacteria 11044339
207 8048372260 8048369669 Bacteria 11666822
208 8048381194 8048379754 Bacteria 11877923
209 Ga0268266_11654068
210 JGI24739J22299_10016575
211 JGI24737J22298_10019507
212 JGI24735J21928_10068414
213 JGI24738J21930_10021621
214 rootH1_10002067
215 rootH1_10065922
216 rootH1_10119457
217 rootH2_10106675
218 rootL2_10012589
219 rootL2_10080836
220 rootL2_10206566
221 rootH1_10003684
222 rootH1_10033400
223 Ga0070714_100065526
224 Ga0068855_100307474
225 Ga0070664_100687958
226 Ga0068854_100543561
227 Ga0068856_100503836
228 Ga0068856_101741242
229 Ga0068861_100131459
230 Ga0081455_10179510
231 Ga0081455_10264432
232 Ga0075365_10508919
233 Ga0075368_10063368
234 Ga0070715_10018481
235 Ga0075367_10000756
236 Ga0075370_10033554
237 Ga0075370_10240475
238 Ga0099826_10042232
239 Ga0105245_11543190
240 Ga0105243_10287747
241 Ga0105238_10573706
242 Ga0105246_10400381
243 Ga0157369_10895362
244 Ga0157374_10565129
245 Ga0163162_10052176
246 Ga0157372_10342334
247 Ga0163163_10904085
248 Ga0182008_10005993
249 Ga0182007_10002837
250 Ga0209758_1003155
251 Ga0207426_1102680
252 Ga0207647_10038136
253 Ga0207685_10804790
254 Ga0207663_11397001
255 Ga0207687_11258242
256 Ga0207709_10057872
257 Ga0207679_11470756
258 Ga0207640_10618095
259 Ga0209813_10000650
260 Ga0207428_11164462
261 Ga0307511_10000047
262 Ga0307511_10035952
263 Ga0307511_10059488
264 Ga0307512_10008193
265 Ga0307513_10067161
266 Ga0307509_10016941
267 Ga0307509_10036159
268 Ga0307509_10055491
269 Ga0307509_10618181
270 Ga0307508_10542085
271 Ga0307514_10005418
272 Ga0307514_10051181
273 Ga0307516_10000711
274 Ga0307516_10169756
275 Ga0307516_10297099
276 Ga0307518_10103577
277 Ga0307518_10378655
278 Ga0307507_10119956
279 Ga0307507_10139807
280 Ga0307507_10430497
281 Ga0307510_10030278
282 Ga0307510_10045511
283 Ga0307510_10051029
284 Ga0395899_0162146
285 Ga0395899_0927048
286 Ga0395900_0284150
287 Ga0395900_0402938
288 Ga0395900_1086617
289 Ga0395898_0006955
290 Ga0395898_0076671
291 Ga0395898_0500601
292 Ga0439439_0015530
293 Ga0451853_0046932
294 Ga0451853_0666630
295 Ga0451853_0839500
296 Ga0439457_024178
297 Ga0450894_000046
298 Ga0450898_002764
299 Ga0450899_001518
300 Ga0450906_000417
301 Ga0466969_0020886
302 Ga0466972_0000851
303 Ga0466972_0055434
304 Ga0466972_0130794
305 Ga0466972_0342140
306 Ga0466965_0005719
307 Ga0466965_0010295
308 Ga0466965_0081909
309 Ga0466966_0024286
310 Ga0466961_0017761
311 Ga0466961_0505484
312 Ga0466963_0000279
313 Ga0466964_0011874
314 Ga0466964_0226424
315 Ga0466970_0001245
316 Ga0466970_0002248
317 Ga0466957_0000404
318 Ga0466960_0003652
319 Ga0466960_0336531
320 Ga0466959_0000297
321 Ga0466958_0030577
322 Ga0466967_0018653
323 Ga0466967_0069175
324 Ga0466967_1255583
325 Ga0495629_0050995
326 Ga0495629_0055899
327 Ga0495651_0020897
328 Ga0495582_0185949
329 Ga0495662_0001234
330 Ga0495664_0000236
331 Ga0495618_0023081
332 Ga0495628_0090220
333 Ga0495630_0035370
334 Ga0495652_0023380
335 Ga0495640_0094570
336 Ga0495587_0053810
337 Ga0495645_0192290
338 Ga0495634_0003864
339 Ga0495625_0026266
340 Ga0495635_0061423
341 Ga0495599_0198440
342 Ga0495623_0251948
343 Ga0495646_0000835
344 Ga0495613_0000319
345 Ga0495613_0702608
346 Ga0495624_0663426
347 Ga0495671_0415950
348 Ga0495600_0021716
349 Ga0495581_0020514
350 Ga0495604_0006154
351 Ga0495636_0101942
352 Ga0495674_0724393
353 Ga0495676_0016697
354 Ga0495687_013004
355 Ga0495687_030387
356 Ga0495685_002836
357 Ga0495686_0119594
358 Ga0495593_0008280
359 Ga0495602_0127088
360 Ga0495614_0014620
361 Ga0495615_0070499
362 Ga0496102_0900523
363 Ga0501033_0527176
364 Ga0501034_0017466
365 Ga0501036_0006831
366 Ga0501047_0028610
367 Ga0501044_0455008
368 nmdc:mga06z11_1372_c1
369 nmdc:mga04h51_1187_c1
370 nmdc:mga07m45_132000_c1
371 nmdc:mga07m45_43776_c1
372 Ga0495619_0061198
373 Ga0500566_0001797
374 Ga0500641_0174457
375 Ga0500650_0105680
376 Ga0500560_027730
377 Ga0500560_112605
378 Ga0500572_013605
379 Ga0500559_0340744
380 Ga0500573_0086248
381 Ga0500573_0435048
382 Ga0500600_0055739
383 Ga0466962_0002489
384 Ga0466962_0396858
385 2585306000
386 2585316407
387 2644265134
388 2644441813
389 2644630799
390 2784586016
391 2785366235
392 2793978225
393 2808917467
394 2809229517
395 2812477200
396 2873319654
397 2877684278
398 2912726805
399 2919473854
400 2946073018
401 2954389615
402 2954700456
403 2954701772
404 2954719132
405 2954729102
406 2954732709
407 2954748002
408 2954751587
409 2954767127
410 2990088799
411 2997457307
412 8047895234
413 8048363717
414 8048372260
415 8048381194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

23

127

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.9578 6 121
3dxo-assembly1.cif.gz_A crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution 0.9343 6 121
6x1i-assembly1.cif.gz_B two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils 0.9185 3 121
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8556 4 122
6x1i-assembly1.cif.gz_B two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils 0.8511 3 121
ID Description Score Start End Superfamily
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9586 7 121 3.10.450.50
3dxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9344 7 121 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8556 4 122 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8487 4 122 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8289 10 118 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7W9QBT7-F1-model_v4 SnoaL-like domain-containing protein 1.003 8 126
AF-A0A497W5U6-F1-model_v4 deleted 1.001 1 125
AF-A0A7H8LBG9-F1-model_v4 deleted 0.9991 1 127
AF-A0A100J6V2-F1-model_v4 deleted 0.9988 1 125
AF-A0A5J6GXV3-F1-model_v4 deleted 0.9988 5 126

Map