F316165

General Info

Members Datasets Scaffolds Average Seq Length
207 139 414 325

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100082390|Ga0070707_1000823903
Length 330
Sequence MARIFHDQDAPLAPLDGRRVAVVGYGNQGRSWALNLRDSGVDVRVGTVADASRRAAEADGFAAHDVADAVRDADVVCLLIPDEVMGEAVVAHVGPALSPGAAVVFASGYAVAFGEVDLPDGVDVTLVAPRMIGVGVRDCYVDGSGFIAFVGVDRDASGNGWPVTLAVARAIGATRRGSVEMTFMQEATIDLFVEQGIAPALQKVWRDAAMVLLEAGIPLEAILAEFYLSGEIERTYRAMREIGPTRQWQLHSQTSQYGTMSRADRYASVDLTAVMRVAVDEITSGAFAKEWAAERSAGYPRMAELRTAEGRDQLMDFEDDVRVKFSPKGS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
34 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
35 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
69 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.76
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100082390 3300005468 Bacteria 3107
2 JGI25407J50210_10000383 3300003373 Bacteria 8485
3 Ga0070669_100381773 3300005353 Bacteria 1149
4 Ga0070675_100026941 3300005354 Bacteria 4616
5 Ga0070714_100150176 3300005435 Bacteria 2099
6 Ga0070711_100147470 3300005439 Bacteria 1771
7 Ga0070708_100001758 3300005445 Bacteria 16628
8 Ga0070706_100009901 3300005467 Bacteria 8850
9 Ga0070706_100071419 3300005467 Bacteria 3211
10 Ga0070707_100102763 3300005468 Bacteria 2769
11 Ga0070698_100022987 3300005471 Bacteria 6519
12 Ga0070699_100362640 3300005518 Bacteria 1306
13 Ga0070697_100141880 3300005536 Bacteria 2021
14 Ga0081455_10006223 3300005937 Bacteria 12859
15 Ga0081538_10000105 3300005981 Bacteria 83102
16 Ga0081538_10002097 3300005981 Bacteria 19865
17 Ga0081538_10027770 3300005981 Bacteria 3912
18 Ga0075428_100172666 3300006844 Bacteria 2342
19 Ga0075428_100189757 3300006844 Bacteria 2223
20 Ga0075428_100229192 3300006844 Bacteria 2004
21 Ga0075430_100004363 3300006846 Bacteria 11944
22 Ga0075430_100198242 3300006846 Bacteria 1667
23 Ga0075430_100303411 3300006846 Bacteria 1321
24 Ga0075431_100002683 3300006847 Bacteria 17245
25 Ga0075431_100013396 3300006847 Bacteria 8285
26 Ga0075431_100022602 3300006847 Bacteria 6429
27 Ga0075431_100103722 3300006847 Bacteria 2935
28 Ga0075431_100201246 3300006847 Bacteria 2037
29 Ga0075433_10001756 3300006852 Bacteria 16209
30 Ga0075434_100012765 3300006871 Bacteria 7973
31 Ga0075434_100286825 3300006871 Bacteria 1666
32 Ga0075429_100019670 3300006880 Bacteria 5853
33 Ga0075429_100035135 3300006880 Bacteria 4358
34 Ga0075429_100226717 3300006880 Bacteria 1637
35 Ga0075436_100047764 3300006914 Bacteria 2953
36 Ga0075435_100002531 3300007076 Bacteria 12167
37 Ga0111539_10139670 3300009094 Bacteria 2837
38 Ga0111539_10155177 3300009094 Bacteria 2679
39 Ga0111539_10694129 3300009094 Bacteria 1185
40 Ga0111539_10787151 3300009094 Bacteria 1107
41 Ga0105245_10041450 3300009098 Bacteria 4104
42 Ga0114129_10014675 3300009147 Bacteria 11161
43 Ga0114129_10050614 3300009147 Bacteria 5835
44 Ga0114129_10090910 3300009147 Bacteria 4230
45 Ga0114129_10425178 3300009147 Bacteria 1746
46 Ga0114129_10466309 3300009147 Bacteria 1655
47 Ga0157378_10065492 3300013297 Bacteria 3253
48 Ga0157379_10514528 3300014968 Bacteria 1110
49 Ga0213876_10049837 3300021384 Bacteria 2213
50 Ga0207646_10033326 3300025922 Bacteria 4660
51 Ga0207646_10158654 3300025922 Bacteria 2041
52 Ga0207687_10011828 3300025927 Bacteria 5708
53 Ga0207687_10105467 3300025927 Bacteria 2082
54 Ga0207708_10097967 3300026075 Bacteria 2266
55 Ga0207428_10044748 3300027907 Bacteria 3569
56 Ga0265338_10000492 3300028800 Bacteria 70548
57 Ga0265330_10018500 3300031235 Bacteria 3200
58 Ga0265332_10000052 3300031238 Bacteria 109708
59 Ga0265328_10003355 3300031239 Bacteria 7081
60 Ga0265320_10074676 3300031240 Bacteria 1591
61 Ga0265325_10004108 3300031241 Bacteria 9268
62 Ga0265325_10026810 3300031241 Bacteria 3118
63 Ga0265329_10005490 3300031242 Bacteria 5121
64 Ga0265339_10003342 3300031249 Bacteria 11232
65 Ga0265339_10072032 3300031249 Bacteria 1839
66 Ga0265339_10086780 3300031249 Bacteria 1646
67 Ga0265331_10000108 3300031250 Bacteria 110148
68 Ga0265331_10019676 3300031250 Bacteria 3482
69 Ga0265327_10004557 3300031251 Bacteria 12210
70 Ga0265327_10026258 3300031251 Bacteria 3377
71 Ga0265327_10101019 3300031251 Bacteria 1392
72 Ga0265316_10002945 3300031344 Bacteria 17419
73 Ga0265313_10001602 3300031595 Bacteria 21012
74 Ga0316579_10020570 3300031691 Unclassified 2930
75 Ga0265314_10000678 3300031711 Bacteria 41446
76 Ga0265314_10091090 3300031711 Bacteria 1985
77 Ga0265342_10031527 3300031712 Bacteria 3276
78 Ga0316576_10044777 3300031727 Bacteria 3198
79 Ga0316578_10020936 3300031728 Bacteria 3623
80 Ga0316577_10000125 3300031733 Bacteria 22427
81 Ga0307413_10010591 3300031824 Bacteria 4484
82 Ga0307410_10004579 3300031852 Bacteria 7172
83 Ga0307409_100216526 3300031995 Bacteria 1726
84 Ga0307416_100095907 3300032002 Bacteria 2563
85 Ga0307411_10139875 3300032005 Bacteria 1783
86 Ga0373926_0053154 3300035083 Bacteria 1465
87 Ga0373956_0004579 3300035119 Bacteria 5524
88 Ga0373935_0256106 3300035692 Unclassified 1226
89 Ga0373933_0013588 3300035724 Bacteria 4515
90 Ga0373937_0008303 3300036401 Bacteria 9015
91 Ga0316582_0000639 3300036647 Bacteria 13680
92 Ga0316584_0036111 3300036712 Bacteria 3667
93 Ga0316584_0098279 3300036712 Bacteria 2192
94 Ga0316584_0126523 3300036712 Bacteria 1908
95 Ga0395898_0389055 3300037466 Unclassified 1330
96 Ga0436365_0266194 3300039437 Bacteria 2443
97 Ga0436360_1235941 3300039438 Bacteria 2054
98 Ga0436361_0250736 3300039447 Bacteria 1637
99 Ga0436361_0880231 3300039447 Bacteria 5795
100 Ga0436363_0248302 3300039450 Bacteria 1131
101 Ga0436362_0100484 3300039453 Bacteria 7757
102 Ga0439450_004456 3300042008 Bacteria 2391
103 Ga0439455_0004495 3300042012 Bacteria 2766
104 Ga0439463_011553 3300042016 Bacteria 2167
105 Ga0439444_0002244 3300042437 Bacteria 2619
106 Ga0466965_0086874 3300044683 Bacteria 1587
107 Ga0466966_0092744 3300044684 Bacteria 1873
108 Ga0466963_0079686 3300044694 Bacteria 2216
109 Ga0466957_0023573 3300044842 Bacteria 3639
110 Ga0466959_0018282 3300045049 Bacteria 5147
111 Ga0466958_0093980 3300045836 Bacteria 1857
112 Ga0495651_0239340 3300046462 Bacteria 1246
113 Ga0495608_0096490 3300046511 Bacteria 1910
114 Ga0495618_0118853 3300046514 Bacteria 1693
115 Ga0495628_0028274 3300046516 Bacteria 4557
116 Ga0495630_0023723 3300046517 Bacteria 4535
117 Ga0495630_0089723 3300046517 Bacteria 2322
118 Ga0495666_0057709 3300046526 Bacteria 1858
119 Ga0495665_0092782 3300046531 Unclassified 1587
120 Ga0495665_0143009 3300046531 Bacteria 1250
121 Ga0495586_0003659 3300046535 Bacteria 8247
122 Ga0495634_0010018 3300046642 Bacteria 6957
123 Ga0495635_0153989 3300046663 Bacteria 1565
124 Ga0495658_0161198 3300046683 Bacteria 1383
125 Ga0495658_0227067 3300046683 Bacteria 1170
126 Ga0495613_0000400 3300046689 Bacteria 37128
127 Ga0495613_0060628 3300046689 Bacteria 2771
128 Ga0495672_0001330 3300047320 Bacteria 24556
129 Ga0495676_0069291 3300047321 Bacteria 2722
130 Ga0495676_0129317 3300047321 Unclassified 1826
131 Ga0495676_0306288 3300047321 Bacteria 1070
132 Ga0495684_0147583 3300047471 Bacteria 1760
133 Ga0495602_0071717 3300048088 Bacteria 2957
134 Ga0495614_0037575 3300048089 Bacteria 2077
135 Ga0496100_0084538 3300048903 Bacteria 2151
136 Ga0496101_0033600 3300048904 Bacteria 3618
137 Ga0496102_0104549 3300048905 Bacteria 2634
138 Ga0496102_0217412 3300048905 Bacteria 1801
139 Ga0496107_0090791 3300048910 Bacteria 2232
140 Ga0496109_0017519 3300048912 Bacteria 6281
141 Ga0496109_0077915 3300048912 Bacteria 3051
142 Ga0496110_0195257 3300048913 Unclassified 1838
143 Ga0496111_0154333 3300048914 Bacteria 1704
144 Ga0496112_0024939 3300048915 Bacteria 5737
145 Ga0496112_0044424 3300048915 Bacteria 4353
146 Ga0496113_0121969 3300048916 Bacteria 2038
147 Ga0496114_0433755 3300048917 Bacteria 1164
148 Ga0496115_0002125 3300048918 Bacteria 14158
149 Ga0496118_0002129 3300048921 Bacteria 27657
150 Ga0501032_0117602 3300049569 Bacteria 1758
151 Ga0501033_0004181 3300049570 Bacteria 11620
152 Ga0501036_0010700 3300049572 Bacteria 7584
153 Ga0501036_0165039 3300049572 Bacteria 1867
154 Ga0501039_0110549 3300049575 Bacteria 2148
155 Ga0501040_0018446 3300049576 Bacteria 4631
156 Ga0501040_0039698 3300049576 Bacteria 3202
157 Ga0501041_0009345 3300049577 Bacteria 5776
158 Ga0501046_0065576 3300049580 Bacteria 2832
159 Ga0501068_0037762 3300049584 Bacteria 2891
160 Ga0501070_0001641 3300049586 Bacteria 19817
161 Ga0501070_0017507 3300049586 Bacteria 6015
162 Ga0501071_0057764 3300049587 Bacteria 2804
163 Ga0501071_0090319 3300049587 Bacteria 2249
164 Ga0501071_0107217 3300049587 Bacteria 2063
165 Ga0501071_0270864 3300049587 Bacteria 1284
166 Ga0501072_0038718 3300049588 Bacteria 3742
167 Ga0501072_0072032 3300049588 Bacteria 2731
168 Ga0501073_0000960 3300049589 Bacteria 20748
169 Ga0501073_0043922 3300049589 Bacteria 3151
170 Ga0501074_0072463 3300049590 Bacteria 2475
171 Ga0501075_0001794 3300049591 Bacteria 14129
172 Ga0501076_0040706 3300049592 Bacteria 3652
173 Ga0501077_0004267 3300049593 Bacteria 8641
174 Ga0501079_0007445 3300049741 Bacteria 8283
175 Ga0501079_0013305 3300049741 Bacteria 6272
176 Ga0501080_0023771 3300049742 Bacteria 5679
177 Ga0501081_0015911 3300049743 Bacteria 4967
178 Ga0501083_0003045 3300049744 Bacteria 11651
179 Ga0501083_0172908 3300049744 Bacteria 1412
180 Ga0501045_0133545 3300049824 Bacteria 1845
181 nmdc:mga05p37_17208_c2 3300050507 Bacteria 3675
182 nmdc:mga05p37_399382_c1 3300050507 Bacteria 1605
183 nmdc:mga05p37_518442_c1 3300050507 Unclassified 1364
184 nmdc:mga05p37_532390_c1 3300050507 Bacteria 1341
185 nmdc:mga05p37_83527_c1 3300050507 Bacteria 3935
186 nmdc:mga09592_325411_c1 3300050508 Bacteria 1331
187 nmdc:mga09592_52878_c1 3300050508 Bacteria 3428
188 nmdc:mga09592_6869_c1 3300050508 Bacteria 9260
189 nmdc:mga0qj67_41238_c1 3300050509 Bacteria 3630
190 nmdc:mga06r32_16793_c1 3300050510 Bacteria 6673
191 nmdc:mga06r32_20685_c1 3300050510 Bacteria 6062
192 nmdc:mga06r32_297989_c1 3300050510 Bacteria 1599
193 nmdc:mga06r32_305798_c1 3300050510 Bacteria 1575
194 nmdc:mga08y16_209664_c1 3300050511 Bacteria 2018
195 nmdc:mga08y16_44322_c1 3300050511 Bacteria 4660
196 nmdc:mga0n895_227525_c1 3300050512 Bacteria 1893
197 nmdc:mga0rr50_111996_c1 3300050513 Bacteria 2161
198 nmdc:mga0rr50_215451_c1 3300050513 Bacteria 1584
199 nmdc:mga0a205_4440_c1 3300050515 Bacteria 12596
200 Ga0495612_0061244 3300053078 Bacteria 1559
201 Ga0501084_0003485 3300054114 Bacteria 12784
202 Ga0501084_0035150 3300054114 Bacteria 4189
203 Ga0501084_0149352 3300054114 Bacteria 1969
204 Ga0501082_0176886 3300060353 Bacteria 1855
205 Ga0530510_0001960 3300061734 Bacteria 14093
206 Ga0530510_0015952 3300061734 Bacteria 5311
207 Ga0530510_0133167 3300061734 Bacteria 1829
208 Ga0070707_100082390
209 JGI25407J50210_10000383
210 Ga0070669_100381773
211 Ga0070675_100026941
212 Ga0070714_100150176
213 Ga0070711_100147470
214 Ga0070708_100001758
215 Ga0070706_100009901
216 Ga0070706_100071419
217 Ga0070707_100102763
218 Ga0070698_100022987
219 Ga0070699_100362640
220 Ga0070697_100141880
221 Ga0081455_10006223
222 Ga0081538_10000105
223 Ga0081538_10002097
224 Ga0081538_10027770
225 Ga0075428_100172666
226 Ga0075428_100189757
227 Ga0075428_100229192
228 Ga0075430_100004363
229 Ga0075430_100198242
230 Ga0075430_100303411
231 Ga0075431_100002683
232 Ga0075431_100013396
233 Ga0075431_100022602
234 Ga0075431_100103722
235 Ga0075431_100201246
236 Ga0075433_10001756
237 Ga0075434_100012765
238 Ga0075434_100286825
239 Ga0075429_100019670
240 Ga0075429_100035135
241 Ga0075429_100226717
242 Ga0075436_100047764
243 Ga0075435_100002531
244 Ga0111539_10139670
245 Ga0111539_10155177
246 Ga0111539_10694129
247 Ga0111539_10787151
248 Ga0105245_10041450
249 Ga0114129_10014675
250 Ga0114129_10050614
251 Ga0114129_10090910
252 Ga0114129_10425178
253 Ga0114129_10466309
254 Ga0157378_10065492
255 Ga0157379_10514528
256 Ga0213876_10049837
257 Ga0207646_10033326
258 Ga0207646_10158654
259 Ga0207687_10011828
260 Ga0207687_10105467
261 Ga0207708_10097967
262 Ga0207428_10044748
263 Ga0265338_10000492
264 Ga0265330_10018500
265 Ga0265332_10000052
266 Ga0265328_10003355
267 Ga0265320_10074676
268 Ga0265325_10004108
269 Ga0265325_10026810
270 Ga0265329_10005490
271 Ga0265339_10003342
272 Ga0265339_10072032
273 Ga0265339_10086780
274 Ga0265331_10000108
275 Ga0265331_10019676
276 Ga0265327_10004557
277 Ga0265327_10026258
278 Ga0265327_10101019
279 Ga0265316_10002945
280 Ga0265313_10001602
281 Ga0316579_10020570
282 Ga0265314_10000678
283 Ga0265314_10091090
284 Ga0265342_10031527
285 Ga0316576_10044777
286 Ga0316578_10020936
287 Ga0316577_10000125
288 Ga0307413_10010591
289 Ga0307410_10004579
290 Ga0307409_100216526
291 Ga0307416_100095907
292 Ga0307411_10139875
293 Ga0373926_0053154
294 Ga0373956_0004579
295 Ga0373935_0256106
296 Ga0373933_0013588
297 Ga0373937_0008303
298 Ga0316582_0000639
299 Ga0316584_0036111
300 Ga0316584_0098279
301 Ga0316584_0126523
302 Ga0395898_0389055
303 Ga0436365_0266194
304 Ga0436360_1235941
305 Ga0436361_0250736
306 Ga0436361_0880231
307 Ga0436363_0248302
308 Ga0436362_0100484
309 Ga0439450_004456
310 Ga0439455_0004495
311 Ga0439463_011553
312 Ga0439444_0002244
313 Ga0466965_0086874
314 Ga0466966_0092744
315 Ga0466963_0079686
316 Ga0466957_0023573
317 Ga0466959_0018282
318 Ga0466958_0093980
319 Ga0495651_0239340
320 Ga0495608_0096490
321 Ga0495618_0118853
322 Ga0495628_0028274
323 Ga0495630_0023723
324 Ga0495630_0089723
325 Ga0495666_0057709
326 Ga0495665_0092782
327 Ga0495665_0143009
328 Ga0495586_0003659
329 Ga0495634_0010018
330 Ga0495635_0153989
331 Ga0495658_0161198
332 Ga0495658_0227067
333 Ga0495613_0000400
334 Ga0495613_0060628
335 Ga0495672_0001330
336 Ga0495676_0069291
337 Ga0495676_0129317
338 Ga0495676_0306288
339 Ga0495684_0147583
340 Ga0495602_0071717
341 Ga0495614_0037575
342 Ga0496100_0084538
343 Ga0496101_0033600
344 Ga0496102_0104549
345 Ga0496102_0217412
346 Ga0496107_0090791
347 Ga0496109_0017519
348 Ga0496109_0077915
349 Ga0496110_0195257
350 Ga0496111_0154333
351 Ga0496112_0024939
352 Ga0496112_0044424
353 Ga0496113_0121969
354 Ga0496114_0433755
355 Ga0496115_0002125
356 Ga0496118_0002129
357 Ga0501032_0117602
358 Ga0501033_0004181
359 Ga0501036_0010700
360 Ga0501036_0165039
361 Ga0501039_0110549
362 Ga0501040_0018446
363 Ga0501040_0039698
364 Ga0501041_0009345
365 Ga0501046_0065576
366 Ga0501068_0037762
367 Ga0501070_0001641
368 Ga0501070_0017507
369 Ga0501071_0057764
370 Ga0501071_0090319
371 Ga0501071_0107217
372 Ga0501071_0270864
373 Ga0501072_0038718
374 Ga0501072_0072032
375 Ga0501073_0000960
376 Ga0501073_0043922
377 Ga0501074_0072463
378 Ga0501075_0001794
379 Ga0501076_0040706
380 Ga0501077_0004267
381 Ga0501079_0007445
382 Ga0501079_0013305
383 Ga0501080_0023771
384 Ga0501081_0015911
385 Ga0501083_0003045
386 Ga0501083_0172908
387 Ga0501045_0133545
388 nmdc:mga05p37_17208_c2
389 nmdc:mga05p37_399382_c1
390 nmdc:mga05p37_518442_c1
391 nmdc:mga05p37_532390_c1
392 nmdc:mga05p37_83527_c1
393 nmdc:mga09592_325411_c1
394 nmdc:mga09592_52878_c1
395 nmdc:mga09592_6869_c1
396 nmdc:mga0qj67_41238_c1
397 nmdc:mga06r32_16793_c1
398 nmdc:mga06r32_20685_c1
399 nmdc:mga06r32_297989_c1
400 nmdc:mga06r32_305798_c1
401 nmdc:mga08y16_209664_c1
402 nmdc:mga08y16_44322_c1
403 nmdc:mga0n895_227525_c1
404 nmdc:mga0rr50_111996_c1
405 nmdc:mga0rr50_215451_c1
406 nmdc:mga0a205_4440_c1
407 Ga0495612_0061244
408 Ga0501084_0003485
409 Ga0501084_0035150
410 Ga0501084_0149352
411 Ga0501082_0176886
412 Ga0530510_0001960
413 Ga0530510_0015952
414 Ga0530510_0133167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

14

177

0.99

PF01450

IlvC

Acetohydroxy acid isomeroreductase, catalytic domain

183

326

0.97

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

19

113

0.89

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

2

93

0.88

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

19

106

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aq8-assembly4.cif.gz_DDD error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9427 18 47
8aq8-assembly2.cif.gz_BBB error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9402 18 47
6vo2-assembly1.cif.gz_A crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, nadph and inhibitor. 0.9401 2 315
8aq8-assembly1.cif.gz_AAA error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9382 18 47
8aq8-assembly3.cif.gz_CCC error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.938 18 47
ID Description Score Start End Superfamily
2e5vA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9637 20 48 3.50.50.60
4xdyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9625 3 173 3.40.50.720
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 1 173 3.40.50.720
4xehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 3 173 3.40.50.720
5miqA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9419 20 49 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A538JQK9-F1-model_v4 Ketol-acid reductoisomerase 0.9853 1 325 GO:0004455
GO:0009097
GO:0009099
GO:0016853
AF-A0A538INJ2-F1-model_v4 Ketol-acid reductoisomerase 0.9837 1 257 GO:0004455
GO:0009097
GO:0009099
GO:0016853
AF-A0A7W0LTM1-F1-model_v4 KARI C-terminal knotted domain-containing protein 0.9781 166 322 GO:0004455
GO:0009082
AF-A0A497I8L9-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9778 1 178 GO:0004455
GO:0009097
GO:0009099
GO:0016853
AF-A0A538BCV4-F1-model_v4 Ketol-acid reductoisomerase 0.9773 1 323 GO:0004455
GO:0009097
GO:0009099
GO:0016853

Map