F316062

General Info

Members Datasets Scaffolds Average Seq Length
207 146 414 511

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10073571|Ga0070692_100735711
Length 559
Sequence MRLSARRTAAHTRWEPPAVRPRMRRRSRRPGILTPVLDRPRKITLAWAALFLGLSALLALAVTGERTPLGPLDDLGRQLEDWADEHDALREVLRFIETWLNQLPILVLTLVLAAXXXXRRHRRAAIYAVLVVFSTWIITSLLKIAIGRARPEWQDTVGLVDSRSYPSGHTSANAALMAVLCVLASMLIRRAQVRRLVYVLCALEVVVIWVDRVLLGRHFPTDVLGGTFLAIGMALFWLAVFSPLPRSHAAHAEPLHEAVPSSRQLTVILNPIKVEDVDRFRSIVAAQAAESGWSEPTWLYTTVEDPGTGMAEAAAVSGADLVLVCGGDGTVREVCAELAGTGIPVGIVPAGTGNLLARNLAIPLFLRSAIDVALNGQDRAIDLVEVSGDGFEDTHFMVMAGMGLDAAIMEGVNEDIKRRVGWIAYVLSGLKALMSPVVKVEIAVDGGEFTTYKAVTVVVGNVGFLQAGLPLLPDAAIDDGVLDVVVLHPKRFLSWVPLAARVLSKGKRNDETIGRLTGQSIVVRASADTPRQLDGDAVGPGRELRMQCVHGRLLVRVPR

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
126 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 2643221561 Nocardioides sp. Root151 Isolate Unclassified
130 2643221576 Nocardioides sp. Root614 Isolate Unclassified
131 2643221590 Nocardioides sp. Root682 Isolate Unclassified
132 2643221604 Nocardioides sp. Root190 Isolate Unclassified
133 2643221615 Nocardioides sp. Root224 Isolate Unclassified
134 2643221617 Nocardioides sp. Root79 Isolate Unclassified
135 2643221620 Nocardioides sp. Root240 Isolate Unclassified
136 2643221641 Nocardioides sp. Root122 Isolate Unclassified
137 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
138 2643221696 Nocardioides sp. Root140 Isolate Unclassified
139 2738541305 Nocardioides sp. CF167 Isolate Unclassified
140 2739367898 Nocardioides sp. CF479 Isolate Unclassified
141 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
142 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
143 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
144 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
145 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
146 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.97
Bulb 0
Endosphere 9.18
Nodule 0.48
Rhizoplane 8.21
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10073571 3300005345 Bacteria 1826
2 JGI24738J21930_10001926 3300002075 Bacteria 5606
3 JGI24744J21845_10010424 3300002077 Bacteria 1904
4 Ga0070658_10147219 3300005327 Bacteria 1970
5 Ga0070658_10187198 3300005327 Bacteria 1744
6 Ga0070680_100113397 3300005336 Bacteria 2258
7 Ga0070682_100014135 3300005337 Bacteria 4610
8 Ga0068868_100030650 3300005338 Bacteria 4125
9 Ga0070660_100017651 3300005339 Bacteria 5203
10 Ga0070660_100037828 3300005339 Bacteria 3659
11 Ga0070692_10025665 3300005345 Bacteria 2906
12 Ga0070659_100009537 3300005366 Bacteria 7134
13 Ga0070700_100077657 3300005441 Bacteria 2136
14 Ga0068867_100002890 3300005459 Bacteria 12086
15 Ga0070685_10066157 3300005466 Bacteria 2129
16 Ga0070698_100001974 3300005471 Bacteria 22807
17 Ga0070679_100010192 3300005530 Bacteria 8908
18 Ga0070684_100001489 3300005535 Bacteria 16896
19 Ga0070684_100081492 3300005535 Bacteria 2864
20 Ga0070672_100001752 3300005543 Bacteria 13576
21 Ga0068855_100081696 3300005563 Bacteria 3746
22 Ga0070664_100044498 3300005564 Bacteria 3749
23 Ga0070664_100094274 3300005564 Bacteria 2596
24 Ga0068857_100029655 3300005577 Bacteria 4828
25 Ga0070702_100010864 3300005615 Bacteria 4506
26 Ga0070702_100067758 3300005615 Bacteria 2098
27 Ga0068864_100098987 3300005618 Bacteria 2583
28 Ga0068866_10009291 3300005718 Bacteria 4169
29 Ga0068861_100122058 3300005719 Bacteria 2103
30 Ga0068870_10003130 3300005840 Bacteria 6981
31 Ga0068860_100046208 3300005843 Bacteria 4152
32 Ga0075365_10000516 3300006038 Bacteria 14767
33 Ga0075365_10011876 3300006038 Bacteria 5142
34 Ga0075365_10037430 3300006038 Bacteria 3150
35 Ga0075365_10080011 3300006038 Bacteria 2212
36 Ga0075368_10004454 3300006042 Bacteria 4751
37 Ga0075364_10014361 3300006051 Bacteria 4893
38 Ga0075364_10063840 3300006051 Bacteria 2418
39 Ga0075367_10012718 3300006178 Bacteria 4501
40 Ga0075370_10051237 3300006353 Bacteria 2342
41 Ga0075428_100055645 3300006844 Bacteria 4335
42 Ga0068865_100094102 3300006881 Bacteria 2180
43 Ga0105245_10002144 3300009098 Bacteria 17875
44 Ga0105245_10052893 3300009098 Bacteria 3644
45 Ga0105243_10008582 3300009148 Bacteria 7840
46 Ga0105248_10180197 3300009177 Bacteria 2381
47 Ga0105237_10131349 3300009545 Bacteria 2499
48 Ga0105239_10003004 3300010375 Bacteria 21030
49 Ga0105239_10004204 3300010375 Bacteria 17287
50 Ga0105239_10057032 3300010375 Bacteria 4285
51 Ga0105239_10316925 3300010375 Bacteria 1758
52 Ga0163162_10042269 3300013306 Bacteria 4561
53 Ga0157372_10002605 3300013307 Bacteria 19511
54 Ga0157372_10049154 3300013307 Bacteria 4689
55 Ga0157375_10052120 3300013308 Bacteria 4021
56 Ga0163163_10008843 3300014325 Bacteria 8965
57 Ga0163163_10058714 3300014325 Bacteria 3804
58 Ga0157380_10002931 3300014326 Bacteria 11597
59 Ga0157380_10078362 3300014326 Bacteria 2695
60 Ga0157377_10026929 3300014745 Bacteria 3082
61 Ga0163161_10002659 3300017792 Bacteria 12700
62 Ga0207642_10005400 3300025899 Bacteria 4169
63 Ga0207688_10009879 3300025901 Bacteria 5193
64 Ga0207647_10010790 3300025904 Bacteria 6431
65 Ga0207647_10054125 3300025904 Bacteria 2470
66 Ga0207643_10007423 3300025908 Bacteria 5880
67 Ga0207705_10103081 3300025909 Bacteria 2101
68 Ga0207657_10002357 3300025919 Bacteria 20456
69 Ga0207657_10027383 3300025919 Bacteria 5221
70 Ga0207652_10051744 3300025921 Bacteria 3522
71 Ga0207669_10012780 3300025937 Bacteria 4141
72 Ga0207704_10011021 3300025938 Bacteria 4435
73 Ga0207691_10006931 3300025940 Bacteria 10928
74 Ga0207661_10008292 3300025944 Bacteria 7425
75 Ga0207661_10008888 3300025944 Bacteria 7192
76 Ga0207640_10042444 3300025981 Bacteria 2900
77 Ga0207708_10000523 3300026075 Bacteria 29609
78 Ga0207708_10015425 3300026075 Bacteria 5732
79 Ga0207648_10003678 3300026089 Bacteria 16046
80 Ga0207675_100001254 3300026118 Bacteria 25321
81 Ga0207675_100039208 3300026118 Bacteria 4421
82 Ga0207428_10049123 3300027907 Bacteria 3382
83 Ga0268266_10000555 3300028379 Bacteria 52036
84 Ga0268264_10068936 3300028381 Bacteria 2990
85 Ga0307405_10058000 3300031731 Bacteria 2435
86 Ga0307410_10034346 3300031852 Bacteria 3284
87 Ga0307410_10053217 3300031852 Bacteria 2738
88 Ga0307407_10054005 3300031903 Bacteria 2314
89 Ga0307412_10034941 3300031911 Bacteria 3207
90 Ga0307409_100011266 3300031995 Bacteria 5624
91 Ga0307409_100015814 3300031995 Bacteria 4968
92 Ga0307416_100000844 3300032002 Bacteria 16142
93 Ga0307416_100058317 3300032002 Bacteria 3129
94 Ga0307415_100000131 3300032126 Bacteria 32506
95 Ga0307415_100026490 3300032126 Bacteria 3658
96 Ga0307415_100029176 3300032126 Bacteria 3522
97 Ga0395900_0015593 3300037418 Bacteria 7746
98 Ga0395898_0038208 3300037466 Bacteria 4759
99 Ga0395898_0129498 3300037466 Bacteria 2417
100 Ga0395901_0018724 3300038443 Bacteria 7074
101 Ga0439434_0010381 3300042435 Bacteria 2745
102 Ga0466972_0032320 3300044658 Bacteria 2570
103 Ga0466961_0020570 3300044693 Bacteria 4246
104 Ga0466971_0029629 3300044719 Bacteria 2448
105 Ga0466970_0006357 3300044765 Bacteria 5903
106 Ga0466970_0019021 3300044765 Bacteria 3559
107 Ga0466970_0068704 3300044765 Bacteria 1904
108 Ga0466957_0047891 3300044842 Bacteria 2598
109 Ga0466957_0067534 3300044842 Bacteria 2206
110 Ga0466957_0082656 3300044842 Bacteria 2002
111 Ga0466957_0101003 3300044842 Bacteria 1818
112 Ga0466960_0000836 3300044901 Bacteria 10859
113 Ga0466959_0027131 3300045049 Bacteria 4248
114 Ga0466959_0139038 3300045049 Bacteria 1718
115 Ga0466958_0055538 3300045836 Bacteria 2403
116 Ga0466967_0002996 3300045976 Bacteria 10822
117 Ga0466967_0152910 3300045976 Bacteria 2158
118 Ga0466967_0187145 3300045976 Bacteria 1955
119 Ga0495657_0117497 3300046675 Bacteria 1678
120 Ga0495658_0053130 3300046683 Bacteria 2300
121 Ga0496104_0002695 3300048907 Bacteria 15291
122 Ga0496104_0114566 3300048907 Bacteria 2586
123 Ga0496105_0009254 3300048908 Bacteria 7696
124 Ga0496106_0106051 3300048909 Bacteria 2184
125 Ga0496107_0016941 3300048910 Bacteria 5124
126 Ga0496108_0076714 3300048911 Bacteria 2825
127 Ga0496108_0135807 3300048911 Bacteria 2116
128 Ga0496108_0205137 3300048911 Unclassified 1711
129 Ga0496109_0013947 3300048912 Bacteria 6989
130 Ga0496109_0093812 3300048912 Bacteria 2778
131 Ga0496110_0002455 3300048913 Bacteria 13880
132 Ga0496110_0221468 3300048913 Bacteria 1721
133 Ga0496111_0003337 3300048914 Bacteria 9926
134 Ga0496114_0010206 3300048917 Bacteria 7473
135 Ga0496114_0012495 3300048917 Bacteria 6799
136 Ga0496114_0057269 3300048917 Bacteria 3253
137 Ga0496115_0002510 3300048918 Bacteria 13178
138 Ga0501032_0027317 3300049569 Bacteria 3922
139 Ga0501033_0096894 3300049570 Bacteria 2156
140 Ga0501034_0008956 3300049571 Bacteria 10519
141 Ga0501036_0013427 3300049572 Bacteria 6806
142 Ga0501037_0020498 3300049573 Bacteria 4882
143 Ga0501038_0005199 3300049574 Bacteria 12108
144 Ga0501039_0012991 3300049575 Bacteria 6367
145 Ga0501039_0046522 3300049575 Bacteria 3352
146 Ga0501039_0178019 3300049575 Bacteria 1672
147 Ga0501042_0083747 3300049578 Bacteria 2286
148 Ga0501043_0080190 3300049579 Bacteria 2564
149 Ga0501046_0000546 3300049580 Bacteria 37423
150 Ga0501046_0005975 3300049580 Bacteria 10835
151 Ga0501047_0062528 3300049581 Bacteria 3590
152 Ga0501067_0000399 3300049583 Bacteria 23713
153 Ga0501067_0000668 3300049583 Bacteria 18450
154 Ga0501067_0054849 3300049583 Bacteria 2208
155 Ga0501068_0000781 3300049584 Bacteria 16429
156 Ga0501069_0002694 3300049585 Bacteria 9066
157 Ga0501070_0001423 3300049586 Bacteria 21420
158 Ga0501070_0008897 3300049586 Bacteria 8487
159 Ga0501070_0065197 3300049586 Bacteria 3015
160 Ga0501071_0047170 3300049587 Bacteria 3095
161 Ga0501071_0051530 3300049587 Bacteria 2966
162 Ga0501072_0003746 3300049588 Bacteria 11476
163 Ga0501072_0019719 3300049588 Bacteria 5216
164 Ga0501073_0040358 3300049589 Bacteria 3303
165 Ga0501073_0071773 3300049589 Bacteria 2411
166 Ga0501074_0010130 3300049590 Bacteria 6845
167 Ga0501075_0104035 3300049591 Bacteria 2158
168 Ga0501077_0002325 3300049593 Bacteria 11444
169 Ga0501079_0002798 3300049741 Bacteria 12714
170 Ga0501080_0002098 3300049742 Bacteria 17309
171 Ga0501080_0061325 3300049742 Bacteria 3501
172 Ga0501083_0012608 3300049744 Bacteria 5913
173 Ga0501035_0005810 3300049822 Bacteria 11632
174 Ga0501045_0065775 3300049824 Bacteria 2662
175 nmdc:mga03n38_16242_c1 3300050490 Bacteria 2893
176 nmdc:mga03n38_4407_c1 3300050490 Bacteria 4661
177 nmdc:mga00v17_28319_c1 3300050491 Bacteria 3280
178 nmdc:mga00v17_3926_c1 3300050491 Bacteria 7668
179 nmdc:mga0yw44_113719_c1 3300050492 Bacteria 1737
180 nmdc:mga0yw44_4005_c1 3300050492 Bacteria 6661
181 nmdc:mga0yw44_54559_c1 3300050492 Bacteria 2429
182 nmdc:mga07m45_18681_c1 3300050496 Bacteria 3749
183 Ga0500644_0000049 3300053088 Bacteria 72195
184 Ga0500593_001046 3300053117 Bacteria 10029
185 Ga0501084_0014068 3300054114 Bacteria 6626
186 Ga0501084_0040025 3300054114 Bacteria 3920
187 Ga0501084_0177564 3300054114 Bacteria 1798
188 Ga0501082_0004151 3300060353 Bacteria 12662
189 Ga0501082_0037057 3300060353 Bacteria 4201
190 2643825084 2643221561 Bacteria 4984412
191 2643890828 2643221576 Bacteria 5214352
192 2643959884 2643221590 Bacteria 5214697
193 2644032685 2643221604 Bacteria 5014917
194 2644092132 2643221615 Bacteria 5487866
195 2644100890 2643221617 Bacteria 5139111
196 2644117299 2643221620 Bacteria 5134593
197 2644231870 2643221641 Bacteria 4490190
198 2644321935 2643221657 Bacteria 5490246
199 2644534610 2643221696 Bacteria 5431823
200 2738869107 2738541305 Bacteria 4910150
201 2740168749 2739367898 Bacteria 4367674
202 2812330583 2811994874 Bacteria 5367947
203 2855390406 2855386786 Bacteria 4752232
204 2857485005 2857481737 Bacteria 4761446
205 2984577932 2984576629 Bacteria 4248407
206 2990260098 2990256926 Bacteria 4252839
207 8054611668 8054609563 Bacteria 5170090
208 Ga0070692_10073571
209 JGI24738J21930_10001926
210 JGI24744J21845_10010424
211 Ga0070658_10147219
212 Ga0070658_10187198
213 Ga0070680_100113397
214 Ga0070682_100014135
215 Ga0068868_100030650
216 Ga0070660_100017651
217 Ga0070660_100037828
218 Ga0070692_10025665
219 Ga0070659_100009537
220 Ga0070700_100077657
221 Ga0068867_100002890
222 Ga0070685_10066157
223 Ga0070698_100001974
224 Ga0070679_100010192
225 Ga0070684_100001489
226 Ga0070684_100081492
227 Ga0070672_100001752
228 Ga0068855_100081696
229 Ga0070664_100044498
230 Ga0070664_100094274
231 Ga0068857_100029655
232 Ga0070702_100010864
233 Ga0070702_100067758
234 Ga0068864_100098987
235 Ga0068866_10009291
236 Ga0068861_100122058
237 Ga0068870_10003130
238 Ga0068860_100046208
239 Ga0075365_10000516
240 Ga0075365_10011876
241 Ga0075365_10037430
242 Ga0075365_10080011
243 Ga0075368_10004454
244 Ga0075364_10014361
245 Ga0075364_10063840
246 Ga0075367_10012718
247 Ga0075370_10051237
248 Ga0075428_100055645
249 Ga0068865_100094102
250 Ga0105245_10002144
251 Ga0105245_10052893
252 Ga0105243_10008582
253 Ga0105248_10180197
254 Ga0105237_10131349
255 Ga0105239_10003004
256 Ga0105239_10004204
257 Ga0105239_10057032
258 Ga0105239_10316925
259 Ga0163162_10042269
260 Ga0157372_10002605
261 Ga0157372_10049154
262 Ga0157375_10052120
263 Ga0163163_10008843
264 Ga0163163_10058714
265 Ga0157380_10002931
266 Ga0157380_10078362
267 Ga0157377_10026929
268 Ga0163161_10002659
269 Ga0207642_10005400
270 Ga0207688_10009879
271 Ga0207647_10010790
272 Ga0207647_10054125
273 Ga0207643_10007423
274 Ga0207705_10103081
275 Ga0207657_10002357
276 Ga0207657_10027383
277 Ga0207652_10051744
278 Ga0207669_10012780
279 Ga0207704_10011021
280 Ga0207691_10006931
281 Ga0207661_10008292
282 Ga0207661_10008888
283 Ga0207640_10042444
284 Ga0207708_10000523
285 Ga0207708_10015425
286 Ga0207648_10003678
287 Ga0207675_100001254
288 Ga0207675_100039208
289 Ga0207428_10049123
290 Ga0268266_10000555
291 Ga0268264_10068936
292 Ga0307405_10058000
293 Ga0307410_10034346
294 Ga0307410_10053217
295 Ga0307407_10054005
296 Ga0307412_10034941
297 Ga0307409_100011266
298 Ga0307409_100015814
299 Ga0307416_100000844
300 Ga0307416_100058317
301 Ga0307415_100000131
302 Ga0307415_100026490
303 Ga0307415_100029176
304 Ga0395900_0015593
305 Ga0395898_0038208
306 Ga0395898_0129498
307 Ga0395901_0018724
308 Ga0439434_0010381
309 Ga0466972_0032320
310 Ga0466961_0020570
311 Ga0466971_0029629
312 Ga0466970_0006357
313 Ga0466970_0019021
314 Ga0466970_0068704
315 Ga0466957_0047891
316 Ga0466957_0067534
317 Ga0466957_0082656
318 Ga0466957_0101003
319 Ga0466960_0000836
320 Ga0466959_0027131
321 Ga0466959_0139038
322 Ga0466958_0055538
323 Ga0466967_0002996
324 Ga0466967_0152910
325 Ga0466967_0187145
326 Ga0495657_0117497
327 Ga0495658_0053130
328 Ga0496104_0002695
329 Ga0496104_0114566
330 Ga0496105_0009254
331 Ga0496106_0106051
332 Ga0496107_0016941
333 Ga0496108_0076714
334 Ga0496108_0135807
335 Ga0496108_0205137
336 Ga0496109_0013947
337 Ga0496109_0093812
338 Ga0496110_0002455
339 Ga0496110_0221468
340 Ga0496111_0003337
341 Ga0496114_0010206
342 Ga0496114_0012495
343 Ga0496114_0057269
344 Ga0496115_0002510
345 Ga0501032_0027317
346 Ga0501033_0096894
347 Ga0501034_0008956
348 Ga0501036_0013427
349 Ga0501037_0020498
350 Ga0501038_0005199
351 Ga0501039_0012991
352 Ga0501039_0046522
353 Ga0501039_0178019
354 Ga0501042_0083747
355 Ga0501043_0080190
356 Ga0501046_0000546
357 Ga0501046_0005975
358 Ga0501047_0062528
359 Ga0501067_0000399
360 Ga0501067_0000668
361 Ga0501067_0054849
362 Ga0501068_0000781
363 Ga0501069_0002694
364 Ga0501070_0001423
365 Ga0501070_0008897
366 Ga0501070_0065197
367 Ga0501071_0047170
368 Ga0501071_0051530
369 Ga0501072_0003746
370 Ga0501072_0019719
371 Ga0501073_0040358
372 Ga0501073_0071773
373 Ga0501074_0010130
374 Ga0501075_0104035
375 Ga0501077_0002325
376 Ga0501079_0002798
377 Ga0501080_0002098
378 Ga0501080_0061325
379 Ga0501083_0012608
380 Ga0501035_0005810
381 Ga0501045_0065775
382 nmdc:mga03n38_16242_c1
383 nmdc:mga03n38_4407_c1
384 nmdc:mga00v17_28319_c1
385 nmdc:mga00v17_3926_c1
386 nmdc:mga0yw44_113719_c1
387 nmdc:mga0yw44_4005_c1
388 nmdc:mga0yw44_54559_c1
389 nmdc:mga07m45_18681_c1
390 Ga0500644_0000049
391 Ga0500593_001046
392 Ga0501084_0014068
393 Ga0501084_0040025
394 Ga0501084_0177564
395 Ga0501082_0004151
396 Ga0501082_0037057
397 2643825084
398 2643890828
399 2643959884
400 2644032685
401 2644092132
402 2644100890
403 2644117299
404 2644231870
405 2644321935
406 2644534610
407 2738869107
408 2740168749
409 2812330583
410 2855390406
411 2857485005
412 2984577932
413 2990260098
414 8054611668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

124

246

0.91

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

398

556

0.89

PF01513

NAD_kinase

ATP-NAD kinase N-terminal domain

278

360

0.88

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

264

386

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.8445 15 182
2p1r-assembly2.cif.gz_B crystal structure of salmonella typhimurium yegs, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases. 0.8383 207 501
3t5p-assembly1.cif.gz_J crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8365 202 500
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8345 202 500
3t5p-assembly2.cif.gz_G crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8337 202 500
ID Description Score Start End Superfamily
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8857 207 320 3.40.50.10330
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8511 207 320 3.40.50.10330
4werA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8448 206 313 3.40.50.10330
af_Q10SE4_189_349_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8428 335 487 2.60.200.40
af_O05848_2_128_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8368 207 317 3.40.50.10330
ID Description Score Start End GO Terms
AF-A0A1V0KGZ4-F1-model_v4 deleted 0.9386 205 502
AF-A0A327U7X0-F1-model_v4 Undecaprenyl-diphosphatase 0.9378 3 182 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A846LZC7-F1-model_v4 deleted 0.924 206 499
AF-A0A7W0U7D1-F1-model_v4 Phosphatase PAP2 family protein 0.9182 10 177 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A6B2U4S9-F1-model_v4 deleted 0.9123 16 182

Map