F316040

General Info

Members Datasets Scaffolds Average Seq Length
207 133 414 130

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100675674|Ga0068868_1006756741
Length 143
Sequence LLLLFQGNTGRTKIILVDTHVVVWLAFDQSHLSKNARAAIDDARLKGDGLAICDITLLELAALSSKGRIRLNVSLESFLHEIEARFVVLPISGRACVRALELPAAYPKDPADRIIGGTALVEGLSLLTADRAIRRSRALRTIW

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 2.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.31
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 46.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100675674 3300005338 Unclassified 922
2 Ga0070658_10047320 3300005327 Bacteria 3481
3 Ga0070660_101112841 3300005339 Unclassified 669
4 Ga0070669_100773067 3300005353 Unclassified 815
5 Ga0070671_100068572 3300005355 Bacteria 2958
6 Ga0070659_100750166 3300005366 Bacteria 846
7 Ga0070709_10005588 3300005434 Bacteria 6809
8 Ga0070709_10221111 3300005434 Bacteria 1350
9 Ga0070709_10335761 3300005434 Bacteria 1113
10 Ga0070714_100522023 3300005435 Bacteria 1134
11 Ga0070713_100119237 3300005436 Bacteria 2311
12 Ga0070713_100913376 3300005436 Unclassified 845
13 Ga0070710_10086292 3300005437 Bacteria 1843
14 Ga0070710_11023653 3300005437 Unclassified 603
15 Ga0070662_101654922 3300005457 Unclassified 553
16 Ga0070681_10339910 3300005458 Bacteria 1411
17 Ga0070681_10582799 3300005458 Bacteria 1033
18 Ga0070706_100010767 3300005467 Bacteria 8487
19 Ga0070706_100183215 3300005467 Bacteria 1956
20 Ga0070706_100235663 3300005467 Unclassified 1709
21 Ga0070707_100242315 3300005468 Bacteria 1755
22 Ga0070707_100278917 3300005468 Unclassified 1624
23 Ga0070707_101332964 3300005468 Unclassified 684
24 Ga0070698_100052225 3300005471 Unclassified 4160
25 Ga0070698_100179203 3300005471 Unclassified 2057
26 Ga0070698_101070420 3300005471 Bacteria 754
27 Ga0070679_100245791 3300005530 Unclassified 1746
28 Ga0070697_100054707 3300005536 Bacteria 3244
29 Ga0070693_100244814 3300005547 Unclassified 1186
30 Ga0070704_100157498 3300005549 Bacteria 1793
31 Ga0068855_100904012 3300005563 Unclassified 932
32 Ga0068854_100087909 3300005578 Bacteria 2306
33 Ga0068856_100002536 3300005614 Bacteria 18825
34 Ga0068856_100121567 3300005614 Unclassified 2613
35 Ga0068856_100767431 3300005614 Bacteria 984
36 Ga0068856_100996758 3300005614 Unclassified 856
37 Ga0068852_101144155 3300005616 Bacteria 799
38 Ga0068851_10252884 3300005834 Unclassified 1000
39 Ga0070717_10009139 3300006028 Bacteria 7446
40 Ga0070717_10096542 3300006028 Plasmid 2504
41 Ga0070717_10831412 3300006028 Bacteria 840
42 Ga0070717_11100696 3300006028 Unclassified 723
43 Ga0070715_10040513 3300006163 Bacteria 1947
44 Ga0070715_10160373 3300006163 Unclassified 1111
45 Ga0070716_100000509 3300006173 Bacteria 16189
46 Ga0070712_100002254 3300006175 Bacteria 11858
47 Ga0070712_100019478 3300006175 Unclassified 4426
48 Ga0070712_101878930 3300006175 Unclassified 524
49 Ga0097621_101039328 3300006237 Unclassified 767
50 Ga0068871_100300131 3300006358 Bacteria 1410
51 Ga0068871_101721858 3300006358 Unclassified 595
52 Ga0075428_102036041 3300006844 Bacteria 595
53 Ga0075431_100266681 3300006847 Bacteria 1736
54 Ga0075433_10158566 3300006852 Bacteria 2014
55 Ga0075436_100030684 3300006914 Bacteria 3699
56 Ga0075436_100402154 3300006914 Unclassified 992
57 Ga0075435_100026880 3300007076 Unclassified 4495
58 Ga0099794_10001150 3300007265 Bacteria 9071
59 Ga0099794_10070452 3300007265 Bacteria 1712
60 Ga0099794_10102818 3300007265 Bacteria 1427
61 Ga0099794_10133296 3300007265 Unclassified 1255
62 Ga0099794_10314077 3300007265 Bacteria 812
63 Ga0099794_10517847 3300007265 Unclassified 628
64 Ga0099795_10037998 3300007788 Bacteria 1697
65 Ga0099795_10352116 3300007788 Unclassified 659
66 Ga0105240_10011810 3300009093 Bacteria 12132
67 Ga0105240_10071280 3300009093 Bacteria 4298
68 Ga0105240_11076598 3300009093 Bacteria 856
69 Ga0105241_10060950 3300009174 Bacteria 2904
70 Ga0105242_11239375 3300009176 Unclassified 767
71 Ga0105248_11641597 3300009177 Unclassified 728
72 Ga0099796_10014420 3300010159 Bacteria 2283
73 Ga0099796_10165116 3300010159 Bacteria 880
74 Ga0105239_10527025 3300010375 Bacteria 1344
75 Ga0157373_10714232 3300013100 Bacteria 735
76 Ga0157371_10288478 3300013102 Bacteria 1186
77 Ga0157370_10011493 3300013104 Bacteria 9251
78 Ga0157370_10277393 3300013104 Bacteria 1549
79 Ga0157370_11196668 3300013104 Unclassified 686
80 Ga0157369_10085799 3300013105 Bacteria 3364
81 Ga0157369_12011594 3300013105 Unclassified 586
82 Ga0157374_10739143 3300013296 Bacteria 998
83 Ga0157378_12673202 3300013297 Unclassified 552
84 Ga0163162_11842955 3300013306 Unclassified 692
85 Ga0157372_10003447 3300013307 Bacteria 17063
86 Ga0157372_10873971 3300013307 Bacteria 1043
87 Ga0157372_12981023 3300013307 Unclassified 541
88 Ga0157376_10003884 3300014969 Bacteria 10333
89 Ga0157376_10924482 3300014969 Unclassified 891
90 Ga0182005_1272385 3300015265 Unclassified 529
91 Ga0184601_137017 3300019183 Unclassified 578
92 Ga0228598_1002269 3300024227 Unclassified 4206
93 Ga0228598_1004908 3300024227 Bacteria 2815
94 Ga0228598_1063365 3300024227 Bacteria 737
95 Ga0207692_10007325 3300025898 Bacteria 4518
96 Ga0207692_10020472 3300025898 Bacteria 3009
97 Ga0207685_10025207 3300025905 Unclassified 2050
98 Ga0207685_10064162 3300025905 Bacteria 1466
99 Ga0207699_10066371 3300025906 Bacteria 2190
100 Ga0207699_10379020 3300025906 Bacteria 1004
101 Ga0207699_10684838 3300025906 Unclassified 750
102 Ga0207684_10029559 3300025910 Bacteria 4666
103 Ga0207684_10113986 3300025910 Bacteria 2315
104 Ga0207695_10067829 3300025913 Bacteria 3657
105 Ga0207693_10003127 3300025915 Bacteria 14246
106 Ga0207693_10046374 3300025915 Bacteria 3414
107 Ga0207693_11184293 3300025915 Bacteria 577
108 Ga0207663_10114623 3300025916 Bacteria 1835
109 Ga0207663_10220673 3300025916 Unclassified 1379
110 Ga0207652_10957521 3300025921 Unclassified 754
111 Ga0207646_10179206 3300025922 Bacteria 1914
112 Ga0207646_11542554 3300025922 Unclassified 574
113 Ga0207681_10679677 3300025923 Unclassified 855
114 Ga0207700_10172476 3300025928 Bacteria 1805
115 Ga0207700_10681664 3300025928 Unclassified 917
116 Ga0207664_10270611 3300025929 Bacteria 1488
117 Ga0207664_10346375 3300025929 Unclassified 1314
118 Ga0207665_10001778 3300025939 Bacteria 14507
119 Ga0207665_10176459 3300025939 Unclassified 1546
120 Ga0207679_10244816 3300025945 Bacteria 1521
121 Ga0207667_11417344 3300025949 Unclassified 668
122 Ga0207640_10053469 3300025981 Bacteria 2636
123 Ga0207677_10764667 3300026023 Unclassified 862
124 Ga0207639_10193629 3300026041 Bacteria 1738
125 Ga0207702_10028739 3300026078 Bacteria 4623
126 Ga0207702_10566359 3300026078 Bacteria 1112
127 Ga0207702_10656252 3300026078 Unclassified 1032
128 Ga0207702_11502013 3300026078 Unclassified 667
129 Ga0207641_10121954 3300026088 Bacteria 2328
130 Ga0209588_1054699 3300027671 Unclassified 1290
131 Ga0209588_1077774 3300027671 Unclassified 1072
132 Ga0209588_1082599 3300027671 Bacteria 1038
133 Ga0265356_1006240 3300028017 Bacteria 1399
134 Ga0265336_10162225 3300028666 Unclassified 665
135 Ga0265338_10009150 3300028800 Bacteria 11888
136 Ga0265338_10057913 3300028800 Unclassified 3424
137 Ga0265338_10098856 3300028800 Bacteria 2386
138 Ga0265338_10202333 3300028800 Unclassified 1497
139 Ga0265338_10230718 3300028800 Unclassified 1377
140 Ga0265762_1001894 3300030760 Bacteria 3795
141 Ga0265762_1036784 3300030760 Bacteria 946
142 Ga0265760_10005158 3300031090 Unclassified 3744
143 Ga0265760_10216477 3300031090 Unclassified 652
144 Ga0265325_10047812 3300031241 Unclassified 2214
145 Ga0265340_10390545 3300031247 Unclassified 614
146 Ga0265339_10147986 3300031249 Unclassified 1190
147 Ga0265331_10436830 3300031250 Unclassified 588
148 Ga0265316_10252443 3300031344 Bacteria 1295
149 Ga0265316_10327411 3300031344 Bacteria 1112
150 Ga0265313_10027156 3300031595 Bacteria 3002
151 Ga0316214_1059004 3300033545 Unclassified 560
152 Ga0373943_0190879 3300035170 Unclassified 1130
153 Ga0373955_0588423 3300035172 Unclassified 681
154 Ga0373935_0175631 3300035692 Bacteria 1468
155 Ga0373935_0562592 3300035692 Unclassified 832
156 Ga0373927_0085135 3300035695 Bacteria 2051
157 Ga0373947_0892870 3300035725 Unclassified 607
158 Ga0373937_0709178 3300036401 Bacteria 953
159 Ga0373925_0051386 3300037068 Bacteria 3077
160 Ga0373925_0168943 3300037068 Unclassified 1726
161 Ga0373925_1049356 3300037068 Unclassified 671
162 Ga0451576_0122738 3300045051 Bacteria 2705
163 Ga0466958_1057052 3300045836 Bacteria 530
164 Ga0495603_0058284 3300046455 Bacteria 2284
165 Ga0495580_0036888 3300046472 Bacteria 3510
166 Ga0495580_0042038 3300046472 Bacteria 3258
167 Ga0495580_0049904 3300046472 Unclassified 2960
168 Ga0495580_0934246 3300046472 Unclassified 556
169 Ga0495580_0967133 3300046472 Unclassified 544
170 Ga0495582_0039324 3300046473 Unclassified 2604
171 Ga0495639_0015320 3300046475 Bacteria 3324
172 Ga0495662_0019262 3300046476 Bacteria 3300
173 Ga0495594_0082469 3300046499 Bacteria 1796
174 Ga0495630_0178631 3300046517 Unclassified 1618
175 Ga0495630_0533468 3300046517 Unclassified 900
176 Ga0495640_0006369 3300046533 Bacteria 9342
177 Ga0495586_0141491 3300046535 Unclassified 1350
178 Ga0495622_0088227 3300046557 Unclassified 1426
179 Ga0495634_0053616 3300046642 Bacteria 2701
180 Ga0495635_0052448 3300046663 Plasmid 2810
181 Ga0495658_0474667 3300046683 Unclassified 799
182 Ga0495613_0095866 3300046689 Unclassified 2145
183 Ga0495624_0288748 3300046690 Unclassified 990
184 Ga0495600_0537724 3300046809 Unclassified 715
185 Ga0495581_0019079 3300047315 Unclassified 3980
186 Ga0495636_0505999 3300047318 Unclassified 584
187 Ga0495674_0499908 3300047319 Unclassified 973
188 Ga0495593_0341176 3300047673 Unclassified 749
189 Ga0495602_0500443 3300048088 Unclassified 850
190 Ga0495614_0428823 3300048089 Unclassified 624
191 Ga0496100_0532317 3300048903 Bacteria 908
192 Ga0496100_0599423 3300048903 Unclassified 855
193 Ga0496102_1023985 3300048905 Bacteria 746
194 Ga0496105_0503370 3300048908 Unclassified 951
195 Ga0496106_0919170 3300048909 Unclassified 690
196 Ga0496112_0541304 3300048915 Bacteria 1098
197 Ga0496112_1371839 3300048915 Unclassified 622
198 Ga0496113_1091114 3300048916 Unclassified 626
199 Ga0496114_0514855 3300048917 Unclassified 1058
200 Ga0496115_0013082 3300048918 Bacteria 6266
201 Ga0496115_1263843 3300048918 Unclassified 552
202 Ga0496126_0023694 3300048929 Bacteria 5946
203 Ga0501083_0296147 3300049744 Bacteria 1052
204 nmdc:mga0rr50_198910_c1 3300050513 Bacteria 1646
205 nmdc:mga08x19_6445_c1 3300050514 Bacteria 6952
206 nmdc:mga0a205_26428_c1 3300050515 Bacteria 5535
207 Ga0495619_0194232 3300053085 Unclassified 1405
208 Ga0068868_100675674
209 Ga0070658_10047320
210 Ga0070660_101112841
211 Ga0070669_100773067
212 Ga0070671_100068572
213 Ga0070659_100750166
214 Ga0070709_10005588
215 Ga0070709_10221111
216 Ga0070709_10335761
217 Ga0070714_100522023
218 Ga0070713_100119237
219 Ga0070713_100913376
220 Ga0070710_10086292
221 Ga0070710_11023653
222 Ga0070662_101654922
223 Ga0070681_10339910
224 Ga0070681_10582799
225 Ga0070706_100010767
226 Ga0070706_100183215
227 Ga0070706_100235663
228 Ga0070707_100242315
229 Ga0070707_100278917
230 Ga0070707_101332964
231 Ga0070698_100052225
232 Ga0070698_100179203
233 Ga0070698_101070420
234 Ga0070679_100245791
235 Ga0070697_100054707
236 Ga0070693_100244814
237 Ga0070704_100157498
238 Ga0068855_100904012
239 Ga0068854_100087909
240 Ga0068856_100002536
241 Ga0068856_100121567
242 Ga0068856_100767431
243 Ga0068856_100996758
244 Ga0068852_101144155
245 Ga0068851_10252884
246 Ga0070717_10009139
247 Ga0070717_10096542
248 Ga0070717_10831412
249 Ga0070717_11100696
250 Ga0070715_10040513
251 Ga0070715_10160373
252 Ga0070716_100000509
253 Ga0070712_100002254
254 Ga0070712_100019478
255 Ga0070712_101878930
256 Ga0097621_101039328
257 Ga0068871_100300131
258 Ga0068871_101721858
259 Ga0075428_102036041
260 Ga0075431_100266681
261 Ga0075433_10158566
262 Ga0075436_100030684
263 Ga0075436_100402154
264 Ga0075435_100026880
265 Ga0099794_10001150
266 Ga0099794_10070452
267 Ga0099794_10102818
268 Ga0099794_10133296
269 Ga0099794_10314077
270 Ga0099794_10517847
271 Ga0099795_10037998
272 Ga0099795_10352116
273 Ga0105240_10011810
274 Ga0105240_10071280
275 Ga0105240_11076598
276 Ga0105241_10060950
277 Ga0105242_11239375
278 Ga0105248_11641597
279 Ga0099796_10014420
280 Ga0099796_10165116
281 Ga0105239_10527025
282 Ga0157373_10714232
283 Ga0157371_10288478
284 Ga0157370_10011493
285 Ga0157370_10277393
286 Ga0157370_11196668
287 Ga0157369_10085799
288 Ga0157369_12011594
289 Ga0157374_10739143
290 Ga0157378_12673202
291 Ga0163162_11842955
292 Ga0157372_10003447
293 Ga0157372_10873971
294 Ga0157372_12981023
295 Ga0157376_10003884
296 Ga0157376_10924482
297 Ga0182005_1272385
298 Ga0184601_137017
299 Ga0228598_1002269
300 Ga0228598_1004908
301 Ga0228598_1063365
302 Ga0207692_10007325
303 Ga0207692_10020472
304 Ga0207685_10025207
305 Ga0207685_10064162
306 Ga0207699_10066371
307 Ga0207699_10379020
308 Ga0207699_10684838
309 Ga0207684_10029559
310 Ga0207684_10113986
311 Ga0207695_10067829
312 Ga0207693_10003127
313 Ga0207693_10046374
314 Ga0207693_11184293
315 Ga0207663_10114623
316 Ga0207663_10220673
317 Ga0207652_10957521
318 Ga0207646_10179206
319 Ga0207646_11542554
320 Ga0207681_10679677
321 Ga0207700_10172476
322 Ga0207700_10681664
323 Ga0207664_10270611
324 Ga0207664_10346375
325 Ga0207665_10001778
326 Ga0207665_10176459
327 Ga0207679_10244816
328 Ga0207667_11417344
329 Ga0207640_10053469
330 Ga0207677_10764667
331 Ga0207639_10193629
332 Ga0207702_10028739
333 Ga0207702_10566359
334 Ga0207702_10656252
335 Ga0207702_11502013
336 Ga0207641_10121954
337 Ga0209588_1054699
338 Ga0209588_1077774
339 Ga0209588_1082599
340 Ga0265356_1006240
341 Ga0265336_10162225
342 Ga0265338_10009150
343 Ga0265338_10057913
344 Ga0265338_10098856
345 Ga0265338_10202333
346 Ga0265338_10230718
347 Ga0265762_1001894
348 Ga0265762_1036784
349 Ga0265760_10005158
350 Ga0265760_10216477
351 Ga0265325_10047812
352 Ga0265340_10390545
353 Ga0265339_10147986
354 Ga0265331_10436830
355 Ga0265316_10252443
356 Ga0265316_10327411
357 Ga0265313_10027156
358 Ga0316214_1059004
359 Ga0373943_0190879
360 Ga0373955_0588423
361 Ga0373935_0175631
362 Ga0373935_0562592
363 Ga0373927_0085135
364 Ga0373947_0892870
365 Ga0373937_0709178
366 Ga0373925_0051386
367 Ga0373925_0168943
368 Ga0373925_1049356
369 Ga0451576_0122738
370 Ga0466958_1057052
371 Ga0495603_0058284
372 Ga0495580_0036888
373 Ga0495580_0042038
374 Ga0495580_0049904
375 Ga0495580_0934246
376 Ga0495580_0967133
377 Ga0495582_0039324
378 Ga0495639_0015320
379 Ga0495662_0019262
380 Ga0495594_0082469
381 Ga0495630_0178631
382 Ga0495630_0533468
383 Ga0495640_0006369
384 Ga0495586_0141491
385 Ga0495622_0088227
386 Ga0495634_0053616
387 Ga0495635_0052448
388 Ga0495658_0474667
389 Ga0495613_0095866
390 Ga0495624_0288748
391 Ga0495600_0537724
392 Ga0495581_0019079
393 Ga0495636_0505999
394 Ga0495674_0499908
395 Ga0495593_0341176
396 Ga0495602_0500443
397 Ga0495614_0428823
398 Ga0496100_0532317
399 Ga0496100_0599423
400 Ga0496102_1023985
401 Ga0496105_0503370
402 Ga0496106_0919170
403 Ga0496112_0541304
404 Ga0496112_1371839
405 Ga0496113_1091114
406 Ga0496114_0514855
407 Ga0496115_0013082
408 Ga0496115_1263843
409 Ga0496126_0023694
410 Ga0501083_0296147
411 nmdc:mga0rr50_198910_c1
412 nmdc:mga08x19_6445_c1
413 nmdc:mga0a205_26428_c1
414 Ga0495619_0194232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

15

139

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.758 2 128
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.7522 2 128
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.749 1 117
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.7343 1 128
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.727 2 128
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9663 2 121 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9055 2 121 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7543 1 122 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7522 2 128 3.40.50.1010
af_P9WF49_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7403 1 123 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q7UYP1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.002 1 130 GO:0000287
GO:0004540
GO:0090729
AF-G8NR29-F1-model_v4 PilT protein domain protein 0.9892 1 130
AF-A0A372IRB3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9874 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A7Y9PDB6-F1-model_v4 PIN domain nuclease of toxin-antitoxin system 0.9861 1 130
AF-A0A1Q3QSS7-F1-model_v4 PIN domain-containing protein 0.9855 1 130

Map