F315652

General Info

Members Datasets Scaffolds Average Seq Length
206 157 412 273

Family's Representative Sequence

Representative Sequence 3300049521|Ga0501298_001622|Ga0501298_001622_2128_3123
Length 331
Sequence VTTFDEKCVRLIKAHPEKLREYAERTVGVGAMYNEERGFMGRRNHDMHRMDRTLIIIGGKEDRSSDKVILGEVARRVGAGKLVVTTVAIPSKPDGLFEEYEKAFRSLGVKHLFKLEINEREEATRDSKLRILDDAAGVFFTGGDQVKITSQIGDTPIFRRIQEIYEAGGVIAGTSAGASVMSETMLVEGGDEESHVIGGSVRMAPGLGLIDGVIIDQHFMERGRVGRLIGAVAQNPKNLGIGIDEQTAIVVERGNGFYVLGSGAVYAIDGSEVSYSNVAEEDLKKTLSIHDMKVHMLSQGDRFDLLTRRPHRMSRRAAEKLPEKEEEMAPA

Samples

Sample ID Description Type Environment
1 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
36 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
37 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
74 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
108 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
114 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
115 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
116 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
117 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
118 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
119 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
120 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
124 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
125 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
126 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
127 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
136 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
137 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
138 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
139 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
140 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
141 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
142 2643221640 Caulobacter sp. Root342 Isolate Unclassified
143 2643221642 Caulobacter sp. Root343 Isolate Unclassified
144 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
145 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
146 2773857925 Microvirga vignae BR3299 Isolate Unclassified
147 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
148 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
149 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
150 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
151 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
152 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
153 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
154 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
155 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
156 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
157 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0
Isolates 11.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.45
Nodule 0.97
Rhizoplane 2.43
Rhizosphere 61.17
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501298_001622 3300049521 Unclassified 3337
2 JGI24739J22299_10000521 3300001989 Bacteria 13726
3 JGI25150J39212_1000717 3300002774 Bacteria 11871
4 JGI25153J46596_10002050 3300003215 Bacteria 11872
5 JGI25153J46596_10016972 3300003215 Bacteria 2888
6 rootL2_10269102 3300003322 Bacteria 2416
7 Ga0055537_1000386 3300003773 Bacteria 29716
8 Ga0055524_1000418 3300003775 Bacteria 35764
9 Ga0055524_1010094 3300003775 Bacteria 3784
10 Ga0055536_1000027 3300003781 Bacteria 164595
11 Ga0055536_1000039 3300003781 Bacteria 131503
12 Ga0055528_1018952 3300003790 Bacteria 2308
13 Ga0055530_10000134 3300003791 Bacteria 65195
14 Ga0055531_10000355 3300003794 Bacteria 44822
15 Ga0055531_10000784 3300003794 Bacteria 26382
16 Ga0065165_1000570 3300005262 Bacteria 54738
17 Ga0070658_10024710 3300005327 Bacteria 4818
18 Ga0070658_10391952 3300005327 Bacteria 1192
19 Ga0070670_100053164 3300005331 Bacteria 3478
20 Ga0070666_10045059 3300005335 Bacteria 2956
21 Ga0070668_100005860 3300005347 Bacteria 9109
22 Ga0070669_100013377 3300005353 Bacteria 5834
23 Ga0070667_100000103 3300005367 Bacteria 107232
24 Ga0070693_100023858 3300005547 Bacteria 3274
25 Ga0070665_100263023 3300005548 Unclassified 1726
26 Ga0068857_100332068 3300005577 Unclassified 1405
27 Ga0068854_100019253 3300005578 Bacteria 4597
28 Ga0068851_10002429 3300005834 Bacteria 8182
29 Ga0068863_100000377 3300005841 Bacteria 45378
30 Ga0068858_100261268 3300005842 Bacteria 1646
31 Ga0068862_100198014 3300005844 Bacteria 1810
32 Ga0081539_10000043 3300005985 Bacteria 288108
33 Ga0081539_10107159 3300005985 Unclassified 1413
34 Ga0079104_1026832 3300006946 Bacteria 1483
35 Ga0105247_10074209 3300009101 Bacteria 2133
36 Ga0105237_10010031 3300009545 Bacteria 10105
37 Ga0105237_10365243 3300009545 Bacteria 1448
38 Ga0157369_10002058 3300013105 Bacteria 24272
39 Ga0163162_10089897 3300013306 Bacteria 3152
40 Ga0157375_10004678 3300013308 Bacteria 11904
41 Ga0213876_10001562 3300021384 Bacteria 14078
42 Ga0207425_1000358 3300025245 Bacteria 31539
43 Ga0209129_1001181 3300025258 Bacteria 15025
44 Ga0209565_1000260 3300025263 Bacteria 56000
45 Ga0209673_1000574 3300025273 Bacteria 58553
46 Ga0209675_1014319 3300025291 Bacteria 2421
47 Ga0209676_1000087 3300025292 Bacteria 263734
48 Ga0209676_1000094 3300025292 Bacteria 246535
49 Ga0209025_1000202 3300025294 Bacteria 145750
50 Ga0209564_1008279 3300025295 Bacteria 5162
51 Ga0209758_1000525 3300025297 Bacteria 61243
52 Ga0209758_1000763 3300025297 Bacteria 46387
53 Ga0209050_1000083 3300025298 Bacteria 263734
54 Ga0209050_1000205 3300025298 Bacteria 132077
55 Ga0209256_1000360 3300025299 Bacteria 74074
56 Ga0209256_1000925 3300025299 Bacteria 35879
57 Ga0209051_1005877 3300025303 Bacteria 7052
58 Ga0209257_1000110 3300025304 Bacteria 237242
59 Ga0209257_1003662 3300025304 Bacteria 12884
60 Ga0207656_10003244 3300025321 Bacteria 5567
61 Ga0207680_10020125 3300025903 Bacteria 3584
62 Ga0207705_10020766 3300025909 Bacteria 4687
63 Ga0207671_10212324 3300025914 Bacteria 1514
64 Ga0207681_10016719 3300025923 Bacteria 4596
65 Ga0207650_10096068 3300025925 Bacteria 2273
66 Ga0207668_10000541 3300025972 Bacteria 23747
67 Ga0207640_10010130 3300025981 Bacteria 5300
68 Ga0207640_10032436 3300025981 Bacteria 3239
69 Ga0207658_10000080 3300025986 Bacteria 107226
70 Ga0207703_10373464 3300026035 Unclassified 1317
71 Ga0207641_10000014 3300026088 Bacteria 336170
72 Ga0268266_10653225 3300028379 Unclassified 1012
73 Ga0268265_10093266 3300028380 Bacteria 2412
74 Ga0307515_10056241 3300028794 Bacteria 5724
75 Ga0307408_100012207 3300031548 Bacteria 5685
76 Ga0307408_100101954 3300031548 Bacteria 2188
77 Ga0307408_100171188 3300031548 Unclassified 1734
78 Ga0307405_10000204 3300031731 Bacteria 21623
79 Ga0307405_10028172 3300031731 Bacteria 3268
80 Ga0307405_10146556 3300031731 Bacteria 1654
81 Ga0307405_10180246 3300031731 Unclassified 1516
82 Ga0307413_10071181 3300031824 Bacteria 2190
83 Ga0307406_10009060 3300031901 Bacteria 5566
84 Ga0307406_10155774 3300031901 Unclassified 1636
85 Ga0307406_10213528 3300031901 Unclassified 1429
86 Ga0307407_10085739 3300031903 Unclassified 1917
87 Ga0307412_10001949 3300031911 Bacteria 11413
88 Ga0307412_10013393 3300031911 Bacteria 4808
89 Ga0307412_10039209 3300031911 Bacteria 3056
90 Ga0307412_10086542 3300031911 Bacteria 2181
91 Ga0307409_100068522 3300031995 Unclassified 2807
92 Ga0307409_100757854 3300031995 Bacteria 975
93 Ga0307416_100146578 3300032002 Bacteria 2156
94 Ga0307416_100319353 3300032002 Unclassified 1554
95 Ga0307414_10006285 3300032004 Bacteria 6610
96 Ga0307414_10114989 3300032004 Bacteria 2057
97 Ga0307414_10226620 3300032004 Bacteria 1538
98 Ga0307414_10584953 3300032004 Bacteria 999
99 Ga0307411_10072101 3300032005 Bacteria 2344
100 Ga0307411_10338306 3300032005 Bacteria 1222
101 Ga0307415_100014213 3300032126 Bacteria 4672
102 Ga0307415_100042938 3300032126 Bacteria 3013
103 Ga0307415_100420412 3300032126 Unclassified 1147
104 Ga0307415_100498675 3300032126 Bacteria 1064
105 Ga0242422_00099 3300038699 Bacteria 4110
106 Ga0237816_02222 3300039145 Bacteria 1504
107 Ga0436365_0835215 3300039437 Bacteria 14011
108 Ga0466965_0016728 3300044683 Bacteria 3496
109 Ga0466966_0012057 3300044684 Bacteria 5728
110 Ga0466961_0006517 3300044693 Bacteria 7418
111 Ga0466964_0053554 3300044706 Bacteria 1661
112 Ga0466968_0064105 3300044735 Bacteria 1589
113 Ga0466970_0007507 3300044765 Bacteria 5468
114 Ga0466957_0008974 3300044842 Bacteria 5700
115 Ga0466957_0046388 3300044842 Bacteria 2638
116 Ga0466959_0027186 3300045049 Bacteria 4243
117 Ga0451576_0232213 3300045051 Bacteria 1927
118 Ga0466958_0020693 3300045836 Bacteria 3838
119 Ga0466967_0058820 3300045976 Bacteria 3399
120 Ga0495638_0000279 3300046460 Bacteria 69110
121 Ga0495638_0000374 3300046460 Bacteria 55503
122 Ga0495650_0029339 3300046471 Bacteria 2509
123 Ga0495648_0189099 3300046524 Bacteria 1040
124 Ga0495663_0000001 3300046525 Bacteria 595264
125 Ga0495633_0000179 3300046558 Bacteria 82201
126 Ga0495668_0000067 3300046616 Bacteria 176418
127 Ga0495625_0000011 3300046660 Bacteria 377120
128 Ga0495649_0000147 3300046694 Bacteria 61838
129 Ga0495679_006672 3300047446 Bacteria 4931
130 Ga0495673_0001259 3300047469 Bacteria 20901
131 Ga0495686_0134440 3300047472 Bacteria 1464
132 Ga0496106_0008988 3300048909 Bacteria 7382
133 Ga0496107_0000050 3300048910 Bacteria 63795
134 Ga0496107_0163565 3300048910 Unclassified 1650
135 Ga0496115_0371595 3300048918 Bacteria 1164
136 Ga0496116_0034803 3300048919 Bacteria 3547
137 Ga0496121_0000825 3300048924 Bacteria 56515
138 Ga0496121_0001171 3300048924 Bacteria 46042
139 Ga0496122_0001197 3300048925 Bacteria 44290
140 Ga0496122_0090615 3300048925 Bacteria 2086
141 Ga0496123_0000793 3300048926 Bacteria 51023
142 Ga0496123_0017484 3300048926 Bacteria 5765
143 Ga0496123_0022318 3300048926 Bacteria 4882
144 Ga0496123_0260891 3300048926 Bacteria 849
145 Ga0496124_0000129 3300048927 Bacteria 156648
146 Ga0496124_0002502 3300048927 Bacteria 23906
147 Ga0496124_0020267 3300048927 Bacteria 6152
148 Ga0496124_0183368 3300048927 Bacteria 1608
149 Ga0496125_0217066 3300048928 Bacteria 1236
150 Ga0501296_004587 3300049519 Bacteria 1513
151 Ga0501299_017851 3300049522 Bacteria 1270
152 Ga0501033_0005348 3300049570 Bacteria 10177
153 Ga0501034_0002931 3300049571 Bacteria 19777
154 Ga0501037_0007703 3300049573 Bacteria 7881
155 Ga0501198_000532 3300049649 Unclassified 4731
156 Ga0501206_005344 3300049653 Unclassified 1652
157 Ga0501207_000902 3300049654 Bacteria 3572
158 Ga0501208_013978 3300049655 Bacteria 1206
159 Ga0501214_001114 3300049659 Bacteria 2033
160 Ga0501217_002515 3300049661 Bacteria 3616
161 Ga0501223_001072 3300049663 Bacteria 6455
162 Ga0501224_002952 3300049664 Bacteria 2354
163 Ga0501227_000229 3300049665 Bacteria 11333
164 Ga0501227_038741 3300049665 Unclassified 1170
165 Ga0501227_058763 3300049665 Bacteria 982
166 Ga0501233_000438 3300049668 Bacteria 6586
167 Ga0501235_003234 3300049669 Unclassified 3513
168 Ga0501238_012450 3300049671 Bacteria 1151
169 Ga0501243_016695 3300049675 Bacteria 1186
170 Ga0501251_014834 3300049681 Unclassified 973
171 Ga0501234_002850 3300049707 Bacteria 2718
172 Ga0501283_005585 3300049779 Bacteria 1735
173 Ga0501283_013610 3300049779 Bacteria 1234
174 Ga0501035_0445555 3300049822 Bacteria 1072
175 Ga0501044_0004052 3300049823 Bacteria 16437
176 Ga0500578_0107938 3300053086 Bacteria 1757
177 Ga0500583_0000457 3300053092 Bacteria 12763
178 Ga0500562_001699 3300053108 Bacteria 5472
179 Ga0500658_0000861 3300053134 Bacteria 12452
180 Ga0500616_0000559 3300053153 Bacteria 45881
181 Ga0500616_0088429 3300053153 Bacteria 1540
182 Ga0500627_0003644 3300053158 Bacteria 4813
183 2587916530 2585428106 Bacteria 5179711
184 2600228604 2599185359 Bacteria 4772316
185 2643782114 2643221552 Bacteria 5708754
186 2643834169 2643221563 Bacteria 4726935
187 2644055094 2643221608 Bacteria 4724829
188 2644085800 2643221614 Bacteria 4260023
189 2644225939 2643221640 Bacteria 5258820
190 2644235428 2643221642 Bacteria 5357871
191 2644345023 2643221661 Bacteria 4267604
192 2644369297 2643221666 Bacteria 4265935
193 2774869509 2773857925 Bacteria 6472445
194 2778125727 2775507255 Bacteria 3945731
195 2792459790 2791355048 Bacteria 5832535
196 2792462527 2791355048 Bacteria 5832535
197 2819714586 2818991466 Bacteria 4748179
198 2843747454 2843744320 Bacteria 5659202
199 2843748588 2843744320 Bacteria 5659202
200 2849574396 2849573788 Bacteria 5421256
201 2857505970 2857504554 Bacteria 5369913
202 2882458759 2882456835 Bacteria 6863978
203 2894238748 2894232714 Bacteria 8834183
204 2919142353 2919138771 Bacteria 5281312
205 2928529089 2928526807 Bacteria 4760224
206 2928968606 2928968154 Bacteria 4633371
207 Ga0501298_001622
208 JGI24739J22299_10000521
209 JGI25150J39212_1000717
210 JGI25153J46596_10002050
211 JGI25153J46596_10016972
212 rootL2_10269102
213 Ga0055537_1000386
214 Ga0055524_1000418
215 Ga0055524_1010094
216 Ga0055536_1000027
217 Ga0055536_1000039
218 Ga0055528_1018952
219 Ga0055530_10000134
220 Ga0055531_10000355
221 Ga0055531_10000784
222 Ga0065165_1000570
223 Ga0070658_10024710
224 Ga0070658_10391952
225 Ga0070670_100053164
226 Ga0070666_10045059
227 Ga0070668_100005860
228 Ga0070669_100013377
229 Ga0070667_100000103
230 Ga0070693_100023858
231 Ga0070665_100263023
232 Ga0068857_100332068
233 Ga0068854_100019253
234 Ga0068851_10002429
235 Ga0068863_100000377
236 Ga0068858_100261268
237 Ga0068862_100198014
238 Ga0081539_10000043
239 Ga0081539_10107159
240 Ga0079104_1026832
241 Ga0105247_10074209
242 Ga0105237_10010031
243 Ga0105237_10365243
244 Ga0157369_10002058
245 Ga0163162_10089897
246 Ga0157375_10004678
247 Ga0213876_10001562
248 Ga0207425_1000358
249 Ga0209129_1001181
250 Ga0209565_1000260
251 Ga0209673_1000574
252 Ga0209675_1014319
253 Ga0209676_1000087
254 Ga0209676_1000094
255 Ga0209025_1000202
256 Ga0209564_1008279
257 Ga0209758_1000525
258 Ga0209758_1000763
259 Ga0209050_1000083
260 Ga0209050_1000205
261 Ga0209256_1000360
262 Ga0209256_1000925
263 Ga0209051_1005877
264 Ga0209257_1000110
265 Ga0209257_1003662
266 Ga0207656_10003244
267 Ga0207680_10020125
268 Ga0207705_10020766
269 Ga0207671_10212324
270 Ga0207681_10016719
271 Ga0207650_10096068
272 Ga0207668_10000541
273 Ga0207640_10010130
274 Ga0207640_10032436
275 Ga0207658_10000080
276 Ga0207703_10373464
277 Ga0207641_10000014
278 Ga0268266_10653225
279 Ga0268265_10093266
280 Ga0307515_10056241
281 Ga0307408_100012207
282 Ga0307408_100101954
283 Ga0307408_100171188
284 Ga0307405_10000204
285 Ga0307405_10028172
286 Ga0307405_10146556
287 Ga0307405_10180246
288 Ga0307413_10071181
289 Ga0307406_10009060
290 Ga0307406_10155774
291 Ga0307406_10213528
292 Ga0307407_10085739
293 Ga0307412_10001949
294 Ga0307412_10013393
295 Ga0307412_10039209
296 Ga0307412_10086542
297 Ga0307409_100068522
298 Ga0307409_100757854
299 Ga0307416_100146578
300 Ga0307416_100319353
301 Ga0307414_10006285
302 Ga0307414_10114989
303 Ga0307414_10226620
304 Ga0307414_10584953
305 Ga0307411_10072101
306 Ga0307411_10338306
307 Ga0307415_100014213
308 Ga0307415_100042938
309 Ga0307415_100420412
310 Ga0307415_100498675
311 Ga0242422_00099
312 Ga0237816_02222
313 Ga0436365_0835215
314 Ga0466965_0016728
315 Ga0466966_0012057
316 Ga0466961_0006517
317 Ga0466964_0053554
318 Ga0466968_0064105
319 Ga0466970_0007507
320 Ga0466957_0008974
321 Ga0466957_0046388
322 Ga0466959_0027186
323 Ga0451576_0232213
324 Ga0466958_0020693
325 Ga0466967_0058820
326 Ga0495638_0000279
327 Ga0495638_0000374
328 Ga0495650_0029339
329 Ga0495648_0189099
330 Ga0495663_0000001
331 Ga0495633_0000179
332 Ga0495668_0000067
333 Ga0495625_0000011
334 Ga0495649_0000147
335 Ga0495679_006672
336 Ga0495673_0001259
337 Ga0495686_0134440
338 Ga0496106_0008988
339 Ga0496107_0000050
340 Ga0496107_0163565
341 Ga0496115_0371595
342 Ga0496116_0034803
343 Ga0496121_0000825
344 Ga0496121_0001171
345 Ga0496122_0001197
346 Ga0496122_0090615
347 Ga0496123_0000793
348 Ga0496123_0017484
349 Ga0496123_0022318
350 Ga0496123_0260891
351 Ga0496124_0000129
352 Ga0496124_0002502
353 Ga0496124_0020267
354 Ga0496124_0183368
355 Ga0496125_0217066
356 Ga0501296_004587
357 Ga0501299_017851
358 Ga0501033_0005348
359 Ga0501034_0002931
360 Ga0501037_0007703
361 Ga0501198_000532
362 Ga0501206_005344
363 Ga0501207_000902
364 Ga0501208_013978
365 Ga0501214_001114
366 Ga0501217_002515
367 Ga0501223_001072
368 Ga0501224_002952
369 Ga0501227_000229
370 Ga0501227_038741
371 Ga0501227_058763
372 Ga0501233_000438
373 Ga0501235_003234
374 Ga0501238_012450
375 Ga0501243_016695
376 Ga0501251_014834
377 Ga0501234_002850
378 Ga0501283_005585
379 Ga0501283_013610
380 Ga0501035_0445555
381 Ga0501044_0004052
382 Ga0500578_0107938
383 Ga0500583_0000457
384 Ga0500562_001699
385 Ga0500658_0000861
386 Ga0500616_0000559
387 Ga0500616_0088429
388 Ga0500627_0003644
389 2587916530
390 2600228604
391 2643782114
392 2643834169
393 2644055094
394 2644085800
395 2644225939
396 2644235428
397 2644345023
398 2644369297
399 2774869509
400 2778125727
401 2792459790
402 2792462527
403 2819714586
404 2843747454
405 2843748588
406 2849574396
407 2857505970
408 2882458759
409 2894238748
410 2919142353
411 2928529089
412 2928968606

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03575

Peptidase_S51

Peptidase family S51

54

259

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uqv-assembly2.cif.gz_C pseudobacteroides cellulosolvens pseudo-cphb 0.9491 6 262
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.9479 6 262
7uqv-assembly1.cif.gz_B pseudobacteroides cellulosolvens pseudo-cphb 0.9467 6 262
7uqv-assembly1.cif.gz_A pseudobacteroides cellulosolvens pseudo-cphb 0.9372 6 262
7uqv-assembly1.cif.gz_B pseudobacteroides cellulosolvens pseudo-cphb 0.936 6 262
ID Description Score Start End Superfamily
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8828 4 263 3.40.50.880
3en0C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8732 4 263 3.40.50.880
af_Q9VYH3_5_230_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7466 7 223 3.40.50.880
af_A0A1D6L7F2_93_266_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7175 70 163 3.40.50.880
af_Q4DS63_13_305_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7168 11 249 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A537LWM3-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.974 3 263 GO:0004180
GO:0006508
GO:0008236
AF-A0A3B9EEE8-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.9732 4 268 GO:0006508
GO:0008236
AF-A0A526TVK8-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.9732 75 259 GO:0004180
GO:0006508
GO:0008236
AF-A0A526TVK8-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.9629 75 259 GO:0004180
GO:0006508
GO:0008236
AF-A0A7X0LGY9-F1-model_v4 Cyanophycinase (EC 3.4.15.6) 0.9608 1 263 GO:0004180
GO:0006508
GO:0008236

Map