F315652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 157 | 412 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300049521|Ga0501298_001622|Ga0501298_001622_2128_3123 |
| Length | 331 |
| Sequence | VTTFDEKCVRLIKAHPEKLREYAERTVGVGAMYNEERGFMGRRNHDMHRMDRTLIIIGGKEDRSSDKVILGEVARRVGAGKLVVTTVAIPSKPDGLFEEYEKAFRSLGVKHLFKLEINEREEATRDSKLRILDDAAGVFFTGGDQVKITSQIGDTPIFRRIQEIYEAGGVIAGTSAGASVMSETMLVEGGDEESHVIGGSVRMAPGLGLIDGVIIDQHFMERGRVGRLIGAVAQNPKNLGIGIDEQTAIVVERGNGFYVLGSGAVYAIDGSEVSYSNVAEEDLKKTLSIHDMKVHMLSQGDRFDLLTRRPHRMSRRAAEKLPEKEEEMAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 35 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 36 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 37 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 38 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 39 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 62 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 63 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 64 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 65 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 66 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 67 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 68 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 69 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 70 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 71 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 72 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 73 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 74 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 75 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 76 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 77 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 78 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 79 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 80 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 81 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 82 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 83 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 84 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 85 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 86 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 87 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 99 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 100 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 101 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 102 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 103 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 104 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 105 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 106 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 107 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 108 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 109 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 113 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 114 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 115 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 116 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 117 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 118 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 119 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 120 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 121 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 123 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 124 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 125 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 126 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 127 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 128 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 131 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 132 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 133 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 136 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 137 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 138 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 139 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 140 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 141 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 142 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 143 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 144 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 145 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 146 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 147 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 148 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 149 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 150 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 151 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 152 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 153 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 154 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 155 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 156 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 157 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.35 |
| Metatranscriptomes | 0 |
| Isolates | 11.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.45 |
| Nodule | 0.97 |
| Rhizoplane | 2.43 |
| Rhizosphere | 61.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501298_001622 | 3300049521 | Unclassified | 3337 |
| 2 | JGI24739J22299_10000521 | 3300001989 | Bacteria | 13726 |
| 3 | JGI25150J39212_1000717 | 3300002774 | Bacteria | 11871 |
| 4 | JGI25153J46596_10002050 | 3300003215 | Bacteria | 11872 |
| 5 | JGI25153J46596_10016972 | 3300003215 | Bacteria | 2888 |
| 6 | rootL2_10269102 | 3300003322 | Bacteria | 2416 |
| 7 | Ga0055537_1000386 | 3300003773 | Bacteria | 29716 |
| 8 | Ga0055524_1000418 | 3300003775 | Bacteria | 35764 |
| 9 | Ga0055524_1010094 | 3300003775 | Bacteria | 3784 |
| 10 | Ga0055536_1000027 | 3300003781 | Bacteria | 164595 |
| 11 | Ga0055536_1000039 | 3300003781 | Bacteria | 131503 |
| 12 | Ga0055528_1018952 | 3300003790 | Bacteria | 2308 |
| 13 | Ga0055530_10000134 | 3300003791 | Bacteria | 65195 |
| 14 | Ga0055531_10000355 | 3300003794 | Bacteria | 44822 |
| 15 | Ga0055531_10000784 | 3300003794 | Bacteria | 26382 |
| 16 | Ga0065165_1000570 | 3300005262 | Bacteria | 54738 |
| 17 | Ga0070658_10024710 | 3300005327 | Bacteria | 4818 |
| 18 | Ga0070658_10391952 | 3300005327 | Bacteria | 1192 |
| 19 | Ga0070670_100053164 | 3300005331 | Bacteria | 3478 |
| 20 | Ga0070666_10045059 | 3300005335 | Bacteria | 2956 |
| 21 | Ga0070668_100005860 | 3300005347 | Bacteria | 9109 |
| 22 | Ga0070669_100013377 | 3300005353 | Bacteria | 5834 |
| 23 | Ga0070667_100000103 | 3300005367 | Bacteria | 107232 |
| 24 | Ga0070693_100023858 | 3300005547 | Bacteria | 3274 |
| 25 | Ga0070665_100263023 | 3300005548 | Unclassified | 1726 |
| 26 | Ga0068857_100332068 | 3300005577 | Unclassified | 1405 |
| 27 | Ga0068854_100019253 | 3300005578 | Bacteria | 4597 |
| 28 | Ga0068851_10002429 | 3300005834 | Bacteria | 8182 |
| 29 | Ga0068863_100000377 | 3300005841 | Bacteria | 45378 |
| 30 | Ga0068858_100261268 | 3300005842 | Bacteria | 1646 |
| 31 | Ga0068862_100198014 | 3300005844 | Bacteria | 1810 |
| 32 | Ga0081539_10000043 | 3300005985 | Bacteria | 288108 |
| 33 | Ga0081539_10107159 | 3300005985 | Unclassified | 1413 |
| 34 | Ga0079104_1026832 | 3300006946 | Bacteria | 1483 |
| 35 | Ga0105247_10074209 | 3300009101 | Bacteria | 2133 |
| 36 | Ga0105237_10010031 | 3300009545 | Bacteria | 10105 |
| 37 | Ga0105237_10365243 | 3300009545 | Bacteria | 1448 |
| 38 | Ga0157369_10002058 | 3300013105 | Bacteria | 24272 |
| 39 | Ga0163162_10089897 | 3300013306 | Bacteria | 3152 |
| 40 | Ga0157375_10004678 | 3300013308 | Bacteria | 11904 |
| 41 | Ga0213876_10001562 | 3300021384 | Bacteria | 14078 |
| 42 | Ga0207425_1000358 | 3300025245 | Bacteria | 31539 |
| 43 | Ga0209129_1001181 | 3300025258 | Bacteria | 15025 |
| 44 | Ga0209565_1000260 | 3300025263 | Bacteria | 56000 |
| 45 | Ga0209673_1000574 | 3300025273 | Bacteria | 58553 |
| 46 | Ga0209675_1014319 | 3300025291 | Bacteria | 2421 |
| 47 | Ga0209676_1000087 | 3300025292 | Bacteria | 263734 |
| 48 | Ga0209676_1000094 | 3300025292 | Bacteria | 246535 |
| 49 | Ga0209025_1000202 | 3300025294 | Bacteria | 145750 |
| 50 | Ga0209564_1008279 | 3300025295 | Bacteria | 5162 |
| 51 | Ga0209758_1000525 | 3300025297 | Bacteria | 61243 |
| 52 | Ga0209758_1000763 | 3300025297 | Bacteria | 46387 |
| 53 | Ga0209050_1000083 | 3300025298 | Bacteria | 263734 |
| 54 | Ga0209050_1000205 | 3300025298 | Bacteria | 132077 |
| 55 | Ga0209256_1000360 | 3300025299 | Bacteria | 74074 |
| 56 | Ga0209256_1000925 | 3300025299 | Bacteria | 35879 |
| 57 | Ga0209051_1005877 | 3300025303 | Bacteria | 7052 |
| 58 | Ga0209257_1000110 | 3300025304 | Bacteria | 237242 |
| 59 | Ga0209257_1003662 | 3300025304 | Bacteria | 12884 |
| 60 | Ga0207656_10003244 | 3300025321 | Bacteria | 5567 |
| 61 | Ga0207680_10020125 | 3300025903 | Bacteria | 3584 |
| 62 | Ga0207705_10020766 | 3300025909 | Bacteria | 4687 |
| 63 | Ga0207671_10212324 | 3300025914 | Bacteria | 1514 |
| 64 | Ga0207681_10016719 | 3300025923 | Bacteria | 4596 |
| 65 | Ga0207650_10096068 | 3300025925 | Bacteria | 2273 |
| 66 | Ga0207668_10000541 | 3300025972 | Bacteria | 23747 |
| 67 | Ga0207640_10010130 | 3300025981 | Bacteria | 5300 |
| 68 | Ga0207640_10032436 | 3300025981 | Bacteria | 3239 |
| 69 | Ga0207658_10000080 | 3300025986 | Bacteria | 107226 |
| 70 | Ga0207703_10373464 | 3300026035 | Unclassified | 1317 |
| 71 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 72 | Ga0268266_10653225 | 3300028379 | Unclassified | 1012 |
| 73 | Ga0268265_10093266 | 3300028380 | Bacteria | 2412 |
| 74 | Ga0307515_10056241 | 3300028794 | Bacteria | 5724 |
| 75 | Ga0307408_100012207 | 3300031548 | Bacteria | 5685 |
| 76 | Ga0307408_100101954 | 3300031548 | Bacteria | 2188 |
| 77 | Ga0307408_100171188 | 3300031548 | Unclassified | 1734 |
| 78 | Ga0307405_10000204 | 3300031731 | Bacteria | 21623 |
| 79 | Ga0307405_10028172 | 3300031731 | Bacteria | 3268 |
| 80 | Ga0307405_10146556 | 3300031731 | Bacteria | 1654 |
| 81 | Ga0307405_10180246 | 3300031731 | Unclassified | 1516 |
| 82 | Ga0307413_10071181 | 3300031824 | Bacteria | 2190 |
| 83 | Ga0307406_10009060 | 3300031901 | Bacteria | 5566 |
| 84 | Ga0307406_10155774 | 3300031901 | Unclassified | 1636 |
| 85 | Ga0307406_10213528 | 3300031901 | Unclassified | 1429 |
| 86 | Ga0307407_10085739 | 3300031903 | Unclassified | 1917 |
| 87 | Ga0307412_10001949 | 3300031911 | Bacteria | 11413 |
| 88 | Ga0307412_10013393 | 3300031911 | Bacteria | 4808 |
| 89 | Ga0307412_10039209 | 3300031911 | Bacteria | 3056 |
| 90 | Ga0307412_10086542 | 3300031911 | Bacteria | 2181 |
| 91 | Ga0307409_100068522 | 3300031995 | Unclassified | 2807 |
| 92 | Ga0307409_100757854 | 3300031995 | Bacteria | 975 |
| 93 | Ga0307416_100146578 | 3300032002 | Bacteria | 2156 |
| 94 | Ga0307416_100319353 | 3300032002 | Unclassified | 1554 |
| 95 | Ga0307414_10006285 | 3300032004 | Bacteria | 6610 |
| 96 | Ga0307414_10114989 | 3300032004 | Bacteria | 2057 |
| 97 | Ga0307414_10226620 | 3300032004 | Bacteria | 1538 |
| 98 | Ga0307414_10584953 | 3300032004 | Bacteria | 999 |
| 99 | Ga0307411_10072101 | 3300032005 | Bacteria | 2344 |
| 100 | Ga0307411_10338306 | 3300032005 | Bacteria | 1222 |
| 101 | Ga0307415_100014213 | 3300032126 | Bacteria | 4672 |
| 102 | Ga0307415_100042938 | 3300032126 | Bacteria | 3013 |
| 103 | Ga0307415_100420412 | 3300032126 | Unclassified | 1147 |
| 104 | Ga0307415_100498675 | 3300032126 | Bacteria | 1064 |
| 105 | Ga0242422_00099 | 3300038699 | Bacteria | 4110 |
| 106 | Ga0237816_02222 | 3300039145 | Bacteria | 1504 |
| 107 | Ga0436365_0835215 | 3300039437 | Bacteria | 14011 |
| 108 | Ga0466965_0016728 | 3300044683 | Bacteria | 3496 |
| 109 | Ga0466966_0012057 | 3300044684 | Bacteria | 5728 |
| 110 | Ga0466961_0006517 | 3300044693 | Bacteria | 7418 |
| 111 | Ga0466964_0053554 | 3300044706 | Bacteria | 1661 |
| 112 | Ga0466968_0064105 | 3300044735 | Bacteria | 1589 |
| 113 | Ga0466970_0007507 | 3300044765 | Bacteria | 5468 |
| 114 | Ga0466957_0008974 | 3300044842 | Bacteria | 5700 |
| 115 | Ga0466957_0046388 | 3300044842 | Bacteria | 2638 |
| 116 | Ga0466959_0027186 | 3300045049 | Bacteria | 4243 |
| 117 | Ga0451576_0232213 | 3300045051 | Bacteria | 1927 |
| 118 | Ga0466958_0020693 | 3300045836 | Bacteria | 3838 |
| 119 | Ga0466967_0058820 | 3300045976 | Bacteria | 3399 |
| 120 | Ga0495638_0000279 | 3300046460 | Bacteria | 69110 |
| 121 | Ga0495638_0000374 | 3300046460 | Bacteria | 55503 |
| 122 | Ga0495650_0029339 | 3300046471 | Bacteria | 2509 |
| 123 | Ga0495648_0189099 | 3300046524 | Bacteria | 1040 |
| 124 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 125 | Ga0495633_0000179 | 3300046558 | Bacteria | 82201 |
| 126 | Ga0495668_0000067 | 3300046616 | Bacteria | 176418 |
| 127 | Ga0495625_0000011 | 3300046660 | Bacteria | 377120 |
| 128 | Ga0495649_0000147 | 3300046694 | Bacteria | 61838 |
| 129 | Ga0495679_006672 | 3300047446 | Bacteria | 4931 |
| 130 | Ga0495673_0001259 | 3300047469 | Bacteria | 20901 |
| 131 | Ga0495686_0134440 | 3300047472 | Bacteria | 1464 |
| 132 | Ga0496106_0008988 | 3300048909 | Bacteria | 7382 |
| 133 | Ga0496107_0000050 | 3300048910 | Bacteria | 63795 |
| 134 | Ga0496107_0163565 | 3300048910 | Unclassified | 1650 |
| 135 | Ga0496115_0371595 | 3300048918 | Bacteria | 1164 |
| 136 | Ga0496116_0034803 | 3300048919 | Bacteria | 3547 |
| 137 | Ga0496121_0000825 | 3300048924 | Bacteria | 56515 |
| 138 | Ga0496121_0001171 | 3300048924 | Bacteria | 46042 |
| 139 | Ga0496122_0001197 | 3300048925 | Bacteria | 44290 |
| 140 | Ga0496122_0090615 | 3300048925 | Bacteria | 2086 |
| 141 | Ga0496123_0000793 | 3300048926 | Bacteria | 51023 |
| 142 | Ga0496123_0017484 | 3300048926 | Bacteria | 5765 |
| 143 | Ga0496123_0022318 | 3300048926 | Bacteria | 4882 |
| 144 | Ga0496123_0260891 | 3300048926 | Bacteria | 849 |
| 145 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 146 | Ga0496124_0002502 | 3300048927 | Bacteria | 23906 |
| 147 | Ga0496124_0020267 | 3300048927 | Bacteria | 6152 |
| 148 | Ga0496124_0183368 | 3300048927 | Bacteria | 1608 |
| 149 | Ga0496125_0217066 | 3300048928 | Bacteria | 1236 |
| 150 | Ga0501296_004587 | 3300049519 | Bacteria | 1513 |
| 151 | Ga0501299_017851 | 3300049522 | Bacteria | 1270 |
| 152 | Ga0501033_0005348 | 3300049570 | Bacteria | 10177 |
| 153 | Ga0501034_0002931 | 3300049571 | Bacteria | 19777 |
| 154 | Ga0501037_0007703 | 3300049573 | Bacteria | 7881 |
| 155 | Ga0501198_000532 | 3300049649 | Unclassified | 4731 |
| 156 | Ga0501206_005344 | 3300049653 | Unclassified | 1652 |
| 157 | Ga0501207_000902 | 3300049654 | Bacteria | 3572 |
| 158 | Ga0501208_013978 | 3300049655 | Bacteria | 1206 |
| 159 | Ga0501214_001114 | 3300049659 | Bacteria | 2033 |
| 160 | Ga0501217_002515 | 3300049661 | Bacteria | 3616 |
| 161 | Ga0501223_001072 | 3300049663 | Bacteria | 6455 |
| 162 | Ga0501224_002952 | 3300049664 | Bacteria | 2354 |
| 163 | Ga0501227_000229 | 3300049665 | Bacteria | 11333 |
| 164 | Ga0501227_038741 | 3300049665 | Unclassified | 1170 |
| 165 | Ga0501227_058763 | 3300049665 | Bacteria | 982 |
| 166 | Ga0501233_000438 | 3300049668 | Bacteria | 6586 |
| 167 | Ga0501235_003234 | 3300049669 | Unclassified | 3513 |
| 168 | Ga0501238_012450 | 3300049671 | Bacteria | 1151 |
| 169 | Ga0501243_016695 | 3300049675 | Bacteria | 1186 |
| 170 | Ga0501251_014834 | 3300049681 | Unclassified | 973 |
| 171 | Ga0501234_002850 | 3300049707 | Bacteria | 2718 |
| 172 | Ga0501283_005585 | 3300049779 | Bacteria | 1735 |
| 173 | Ga0501283_013610 | 3300049779 | Bacteria | 1234 |
| 174 | Ga0501035_0445555 | 3300049822 | Bacteria | 1072 |
| 175 | Ga0501044_0004052 | 3300049823 | Bacteria | 16437 |
| 176 | Ga0500578_0107938 | 3300053086 | Bacteria | 1757 |
| 177 | Ga0500583_0000457 | 3300053092 | Bacteria | 12763 |
| 178 | Ga0500562_001699 | 3300053108 | Bacteria | 5472 |
| 179 | Ga0500658_0000861 | 3300053134 | Bacteria | 12452 |
| 180 | Ga0500616_0000559 | 3300053153 | Bacteria | 45881 |
| 181 | Ga0500616_0088429 | 3300053153 | Bacteria | 1540 |
| 182 | Ga0500627_0003644 | 3300053158 | Bacteria | 4813 |
| 183 | 2587916530 | 2585428106 | Bacteria | 5179711 |
| 184 | 2600228604 | 2599185359 | Bacteria | 4772316 |
| 185 | 2643782114 | 2643221552 | Bacteria | 5708754 |
| 186 | 2643834169 | 2643221563 | Bacteria | 4726935 |
| 187 | 2644055094 | 2643221608 | Bacteria | 4724829 |
| 188 | 2644085800 | 2643221614 | Bacteria | 4260023 |
| 189 | 2644225939 | 2643221640 | Bacteria | 5258820 |
| 190 | 2644235428 | 2643221642 | Bacteria | 5357871 |
| 191 | 2644345023 | 2643221661 | Bacteria | 4267604 |
| 192 | 2644369297 | 2643221666 | Bacteria | 4265935 |
| 193 | 2774869509 | 2773857925 | Bacteria | 6472445 |
| 194 | 2778125727 | 2775507255 | Bacteria | 3945731 |
| 195 | 2792459790 | 2791355048 | Bacteria | 5832535 |
| 196 | 2792462527 | 2791355048 | Bacteria | 5832535 |
| 197 | 2819714586 | 2818991466 | Bacteria | 4748179 |
| 198 | 2843747454 | 2843744320 | Bacteria | 5659202 |
| 199 | 2843748588 | 2843744320 | Bacteria | 5659202 |
| 200 | 2849574396 | 2849573788 | Bacteria | 5421256 |
| 201 | 2857505970 | 2857504554 | Bacteria | 5369913 |
| 202 | 2882458759 | 2882456835 | Bacteria | 6863978 |
| 203 | 2894238748 | 2894232714 | Bacteria | 8834183 |
| 204 | 2919142353 | 2919138771 | Bacteria | 5281312 |
| 205 | 2928529089 | 2928526807 | Bacteria | 4760224 |
| 206 | 2928968606 | 2928968154 | Bacteria | 4633371 |
| 207 | Ga0501298_001622 | |||
| 208 | JGI24739J22299_10000521 | |||
| 209 | JGI25150J39212_1000717 | |||
| 210 | JGI25153J46596_10002050 | |||
| 211 | JGI25153J46596_10016972 | |||
| 212 | rootL2_10269102 | |||
| 213 | Ga0055537_1000386 | |||
| 214 | Ga0055524_1000418 | |||
| 215 | Ga0055524_1010094 | |||
| 216 | Ga0055536_1000027 | |||
| 217 | Ga0055536_1000039 | |||
| 218 | Ga0055528_1018952 | |||
| 219 | Ga0055530_10000134 | |||
| 220 | Ga0055531_10000355 | |||
| 221 | Ga0055531_10000784 | |||
| 222 | Ga0065165_1000570 | |||
| 223 | Ga0070658_10024710 | |||
| 224 | Ga0070658_10391952 | |||
| 225 | Ga0070670_100053164 | |||
| 226 | Ga0070666_10045059 | |||
| 227 | Ga0070668_100005860 | |||
| 228 | Ga0070669_100013377 | |||
| 229 | Ga0070667_100000103 | |||
| 230 | Ga0070693_100023858 | |||
| 231 | Ga0070665_100263023 | |||
| 232 | Ga0068857_100332068 | |||
| 233 | Ga0068854_100019253 | |||
| 234 | Ga0068851_10002429 | |||
| 235 | Ga0068863_100000377 | |||
| 236 | Ga0068858_100261268 | |||
| 237 | Ga0068862_100198014 | |||
| 238 | Ga0081539_10000043 | |||
| 239 | Ga0081539_10107159 | |||
| 240 | Ga0079104_1026832 | |||
| 241 | Ga0105247_10074209 | |||
| 242 | Ga0105237_10010031 | |||
| 243 | Ga0105237_10365243 | |||
| 244 | Ga0157369_10002058 | |||
| 245 | Ga0163162_10089897 | |||
| 246 | Ga0157375_10004678 | |||
| 247 | Ga0213876_10001562 | |||
| 248 | Ga0207425_1000358 | |||
| 249 | Ga0209129_1001181 | |||
| 250 | Ga0209565_1000260 | |||
| 251 | Ga0209673_1000574 | |||
| 252 | Ga0209675_1014319 | |||
| 253 | Ga0209676_1000087 | |||
| 254 | Ga0209676_1000094 | |||
| 255 | Ga0209025_1000202 | |||
| 256 | Ga0209564_1008279 | |||
| 257 | Ga0209758_1000525 | |||
| 258 | Ga0209758_1000763 | |||
| 259 | Ga0209050_1000083 | |||
| 260 | Ga0209050_1000205 | |||
| 261 | Ga0209256_1000360 | |||
| 262 | Ga0209256_1000925 | |||
| 263 | Ga0209051_1005877 | |||
| 264 | Ga0209257_1000110 | |||
| 265 | Ga0209257_1003662 | |||
| 266 | Ga0207656_10003244 | |||
| 267 | Ga0207680_10020125 | |||
| 268 | Ga0207705_10020766 | |||
| 269 | Ga0207671_10212324 | |||
| 270 | Ga0207681_10016719 | |||
| 271 | Ga0207650_10096068 | |||
| 272 | Ga0207668_10000541 | |||
| 273 | Ga0207640_10010130 | |||
| 274 | Ga0207640_10032436 | |||
| 275 | Ga0207658_10000080 | |||
| 276 | Ga0207703_10373464 | |||
| 277 | Ga0207641_10000014 | |||
| 278 | Ga0268266_10653225 | |||
| 279 | Ga0268265_10093266 | |||
| 280 | Ga0307515_10056241 | |||
| 281 | Ga0307408_100012207 | |||
| 282 | Ga0307408_100101954 | |||
| 283 | Ga0307408_100171188 | |||
| 284 | Ga0307405_10000204 | |||
| 285 | Ga0307405_10028172 | |||
| 286 | Ga0307405_10146556 | |||
| 287 | Ga0307405_10180246 | |||
| 288 | Ga0307413_10071181 | |||
| 289 | Ga0307406_10009060 | |||
| 290 | Ga0307406_10155774 | |||
| 291 | Ga0307406_10213528 | |||
| 292 | Ga0307407_10085739 | |||
| 293 | Ga0307412_10001949 | |||
| 294 | Ga0307412_10013393 | |||
| 295 | Ga0307412_10039209 | |||
| 296 | Ga0307412_10086542 | |||
| 297 | Ga0307409_100068522 | |||
| 298 | Ga0307409_100757854 | |||
| 299 | Ga0307416_100146578 | |||
| 300 | Ga0307416_100319353 | |||
| 301 | Ga0307414_10006285 | |||
| 302 | Ga0307414_10114989 | |||
| 303 | Ga0307414_10226620 | |||
| 304 | Ga0307414_10584953 | |||
| 305 | Ga0307411_10072101 | |||
| 306 | Ga0307411_10338306 | |||
| 307 | Ga0307415_100014213 | |||
| 308 | Ga0307415_100042938 | |||
| 309 | Ga0307415_100420412 | |||
| 310 | Ga0307415_100498675 | |||
| 311 | Ga0242422_00099 | |||
| 312 | Ga0237816_02222 | |||
| 313 | Ga0436365_0835215 | |||
| 314 | Ga0466965_0016728 | |||
| 315 | Ga0466966_0012057 | |||
| 316 | Ga0466961_0006517 | |||
| 317 | Ga0466964_0053554 | |||
| 318 | Ga0466968_0064105 | |||
| 319 | Ga0466970_0007507 | |||
| 320 | Ga0466957_0008974 | |||
| 321 | Ga0466957_0046388 | |||
| 322 | Ga0466959_0027186 | |||
| 323 | Ga0451576_0232213 | |||
| 324 | Ga0466958_0020693 | |||
| 325 | Ga0466967_0058820 | |||
| 326 | Ga0495638_0000279 | |||
| 327 | Ga0495638_0000374 | |||
| 328 | Ga0495650_0029339 | |||
| 329 | Ga0495648_0189099 | |||
| 330 | Ga0495663_0000001 | |||
| 331 | Ga0495633_0000179 | |||
| 332 | Ga0495668_0000067 | |||
| 333 | Ga0495625_0000011 | |||
| 334 | Ga0495649_0000147 | |||
| 335 | Ga0495679_006672 | |||
| 336 | Ga0495673_0001259 | |||
| 337 | Ga0495686_0134440 | |||
| 338 | Ga0496106_0008988 | |||
| 339 | Ga0496107_0000050 | |||
| 340 | Ga0496107_0163565 | |||
| 341 | Ga0496115_0371595 | |||
| 342 | Ga0496116_0034803 | |||
| 343 | Ga0496121_0000825 | |||
| 344 | Ga0496121_0001171 | |||
| 345 | Ga0496122_0001197 | |||
| 346 | Ga0496122_0090615 | |||
| 347 | Ga0496123_0000793 | |||
| 348 | Ga0496123_0017484 | |||
| 349 | Ga0496123_0022318 | |||
| 350 | Ga0496123_0260891 | |||
| 351 | Ga0496124_0000129 | |||
| 352 | Ga0496124_0002502 | |||
| 353 | Ga0496124_0020267 | |||
| 354 | Ga0496124_0183368 | |||
| 355 | Ga0496125_0217066 | |||
| 356 | Ga0501296_004587 | |||
| 357 | Ga0501299_017851 | |||
| 358 | Ga0501033_0005348 | |||
| 359 | Ga0501034_0002931 | |||
| 360 | Ga0501037_0007703 | |||
| 361 | Ga0501198_000532 | |||
| 362 | Ga0501206_005344 | |||
| 363 | Ga0501207_000902 | |||
| 364 | Ga0501208_013978 | |||
| 365 | Ga0501214_001114 | |||
| 366 | Ga0501217_002515 | |||
| 367 | Ga0501223_001072 | |||
| 368 | Ga0501224_002952 | |||
| 369 | Ga0501227_000229 | |||
| 370 | Ga0501227_038741 | |||
| 371 | Ga0501227_058763 | |||
| 372 | Ga0501233_000438 | |||
| 373 | Ga0501235_003234 | |||
| 374 | Ga0501238_012450 | |||
| 375 | Ga0501243_016695 | |||
| 376 | Ga0501251_014834 | |||
| 377 | Ga0501234_002850 | |||
| 378 | Ga0501283_005585 | |||
| 379 | Ga0501283_013610 | |||
| 380 | Ga0501035_0445555 | |||
| 381 | Ga0501044_0004052 | |||
| 382 | Ga0500578_0107938 | |||
| 383 | Ga0500583_0000457 | |||
| 384 | Ga0500562_001699 | |||
| 385 | Ga0500658_0000861 | |||
| 386 | Ga0500616_0000559 | |||
| 387 | Ga0500616_0088429 | |||
| 388 | Ga0500627_0003644 | |||
| 389 | 2587916530 | |||
| 390 | 2600228604 | |||
| 391 | 2643782114 | |||
| 392 | 2643834169 | |||
| 393 | 2644055094 | |||
| 394 | 2644085800 | |||
| 395 | 2644225939 | |||
| 396 | 2644235428 | |||
| 397 | 2644345023 | |||
| 398 | 2644369297 | |||
| 399 | 2774869509 | |||
| 400 | 2778125727 | |||
| 401 | 2792459790 | |||
| 402 | 2792462527 | |||
| 403 | 2819714586 | |||
| 404 | 2843747454 | |||
| 405 | 2843748588 | |||
| 406 | 2849574396 | |||
| 407 | 2857505970 | |||
| 408 | 2882458759 | |||
| 409 | 2894238748 | |||
| 410 | 2919142353 | |||
| 411 | 2928529089 | |||
| 412 | 2928968606 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7uqv-assembly2.cif.gz_C | pseudobacteroides cellulosolvens pseudo-cphb | 0.9491 | 6 | 262 |
| 7uqv-assembly1.cif.gz_A | pseudobacteroides cellulosolvens pseudo-cphb | 0.9479 | 6 | 262 |
| 7uqv-assembly1.cif.gz_B | pseudobacteroides cellulosolvens pseudo-cphb | 0.9467 | 6 | 262 |
| 7uqv-assembly1.cif.gz_A | pseudobacteroides cellulosolvens pseudo-cphb | 0.9372 | 6 | 262 |
| 7uqv-assembly1.cif.gz_B | pseudobacteroides cellulosolvens pseudo-cphb | 0.936 | 6 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3en0C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8828 | 4 | 263 | 3.40.50.880 |
| 3en0C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8732 | 4 | 263 | 3.40.50.880 |
| af_Q9VYH3_5_230_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7466 | 7 | 223 | 3.40.50.880 |
| af_A0A1D6L7F2_93_266_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7175 | 70 | 163 | 3.40.50.880 |
| af_Q4DS63_13_305_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.7168 | 11 | 249 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537LWM3-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.974 | 3 | 263 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A3B9EEE8-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.9732 | 4 | 268 |
GO:0006508
GO:0008236 |
| AF-A0A526TVK8-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.9732 | 75 | 259 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A526TVK8-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.9629 | 75 | 259 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A7X0LGY9-F1-model_v4 | Cyanophycinase (EC 3.4.15.6) | 0.9608 | 1 | 263 |
GO:0004180
GO:0006508 GO:0008236 |