F315648

General Info

Members Datasets Scaffolds Average Seq Length
206 150 184 428

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_000539|Ga0495678_000539_992_2386
Length 464
Sequence MAVFPQLKRFGAQAARDAATDVDAGSTPLETAARKDRARFSPRPILTFLHRWVGLFIAGFLFVSGVTGAVISWDHELDDVLNPHLMYAQSQGQGTALPALDLAKRIEARDPRVQVTWLPLEPEPGGTLAFGVEPKRDPATGKLFQPRYNQVFVDPVTGVEQGRREWGAVWPITRETFVSFLYVLHYTLHIPAMWGIDRWGVWLLGVVAVLWTIDCFVGFYLTLPPKPVSAKAQKGFWSRWKPAWLIKTKGSAYRINFDIHRAFGLWLWGVLFTVAFTALSLNLYSEVFYPVMSKISKVTPSPFDVRKPADINTPIIAKKSYVEILETAKAEGAKRGWTAPVGALFYSKEYGIYGAGFFAPGGDHGAAGVGPPYLYYDGGDGRLLGDRQPWKGTAADIFVQAQFPLHSGRILGLPGRILISFVGVVVAALSVTGVVIWLKKRKARVKRRMGVAWRGPDGGQLKDV

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
135 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
138 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 0
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.44
Nodule 0
Rhizoplane 0.49
Rhizosphere 46.6
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10014607 3300003187 Bacteria 3491
2 rootH1_10096795 3300003316 Bacteria 3470
3 rootH1_10096795 3300003323 Bacteria 1992
4 rootL2_10005826 3300003322 Bacteria 3581
5 rootH1_10007628 3300003323 Bacteria 37745
6 rootH1_10285547 3300003323 Bacteria 2808
7 Ga0055526_1000001 3300003771 Bacteria 669703
8 Ga0055526_1013264 3300003771 Bacteria 3501
9 Ga0055537_1000432 3300003773 Bacteria 27083
10 Ga0055524_1000015 3300003775 Bacteria 246493
11 Ga0055524_1000586 3300003775 Bacteria 26391
12 Ga0055524_1004011 3300003775 Bacteria 6943
13 Ga0055524_1015328 3300003775 Bacteria 2799
14 Ga0055536_1002198 3300003781 Bacteria 11113
15 Ga0055536_1002641 3300003781 Bacteria 9970
16 Ga0055530_10004228 3300003791 Bacteria 7538
17 Ga0055530_10009897 3300003791 Bacteria 3595
18 Ga0055531_10002793 3300003794 Bacteria 11447
19 Ga0055531_10031657 3300003794 Bacteria 1747
20 Ga0065165_1001159 3300005262 Bacteria 30735
21 Ga0070668_100004405 3300005347 Bacteria 10453
22 Ga0068867_100245296 3300005459 Bacteria 1454
23 Ga0070665_100016270 3300005548 Bacteria 7463
24 Ga0070665_100213943 3300005548 Bacteria 1928
25 Ga0068860_100002126 3300005843 Bacteria 20896
26 Ga0068862_100125637 3300005844 Bacteria 2264
27 Ga0075365_10016190 3300006038 Bacteria 4528
28 Ga0075368_10002727 3300006042 Bacteria 5829
29 Ga0075367_10037941 3300006178 Bacteria 2802
30 Ga0075366_10014085 3300006195 Bacteria 4563
31 Ga0075370_10015434 3300006353 Bacteria 4090
32 Ga0075430_100049400 3300006846 Bacteria 3551
33 Ga0068865_100211700 3300006881 Bacteria 1511
34 Ga0105240_10181347 3300009093 Bacteria 2485
35 Ga0105248_10030807 3300009177 Bacteria 5993
36 Ga0182008_10000605 3300014497 Bacteria 26387
37 Ga0182006_1000002 3300015261 Bacteria 887990
38 Ga0182007_10000428 3300015262 Bacteria 25739
39 Ga0182005_1000002 3300015265 Bacteria 908499
40 Ga0163161_10071257 3300017792 Bacteria 2543
41 Ga0209565_1000077 3300025263 Bacteria 161163
42 Ga0209565_1000491 3300025263 Bacteria 28967
43 Ga0209673_1001891 3300025273 Bacteria 16811
44 Ga0209676_1000067 3300025292 Bacteria 315576
45 Ga0209676_1000134 3300025292 Bacteria 183222
46 Ga0209025_1000231 3300025294 Bacteria 130671
47 Ga0209564_1000002 3300025295 Bacteria 1636803
48 Ga0209564_1000274 3300025295 Bacteria 107980
49 Ga0209564_1000892 3300025295 Bacteria 39200
50 Ga0209564_1007254 3300025295 Bacteria 5760
51 Ga0209564_1027850 3300025295 Bacteria 1824
52 Ga0209758_1001122 3300025297 Bacteria 34484
53 Ga0209758_1001524 3300025297 Bacteria 26819
54 Ga0209050_1000348 3300025298 Bacteria 90399
55 Ga0209050_1001208 3300025298 Bacteria 30295
56 Ga0209050_1015163 3300025298 Bacteria 3259
57 Ga0209256_1000005 3300025299 Bacteria 1315082
58 Ga0209256_1000119 3300025299 Bacteria 168215
59 Ga0209256_1001228 3300025299 Bacteria 28537
60 Ga0209256_1007649 3300025299 Bacteria 5259
61 Ga0209256_1014592 3300025299 Bacteria 2813
62 Ga0209051_1004010 3300025303 Bacteria 9327
63 Ga0209257_1000066 3300025304 Bacteria 344166
64 Ga0209257_1000424 3300025304 Bacteria 81333
65 Ga0209257_1003061 3300025304 Bacteria 15077
66 Ga0209257_1006524 3300025304 Bacteria 7461
67 Ga0207695_10132524 3300025913 Bacteria 2448
68 Ga0207711_10016957 3300025941 Bacteria 6050
69 Ga0207668_10032252 3300025972 Bacteria 3459
70 Ga0268266_10004709 3300028379 Bacteria 12983
71 Ga0268265_10004678 3300028380 Bacteria 9454
72 Ga0268264_10000113 3300028381 Bacteria 203262
73 Ga0307515_10014761 3300028794 Bacteria 14451
74 Ga0265332_10000016 3300031238 Bacteria 229887
75 Ga0307513_10095194 3300031456 Bacteria 3020
76 Ga0307408_100001074 3300031548 Bacteria 20937
77 Ga0265314_10012406 3300031711 Bacteria 6956
78 Ga0307405_10071943 3300031731 Bacteria 2227
79 Ga0307413_10138353 3300031824 Bacteria 1678
80 Ga0307412_10128161 3300031911 Bacteria 1839
81 Ga0439449_0003249 3300042007 Bacteria 6335
82 Ga0495590_0021895 3300046457 Bacteria 2263
83 Ga0495638_0000109 3300046460 Bacteria 131610
84 Ga0495638_0000317 3300046460 Bacteria 62243
85 Ga0495638_0002300 3300046460 Bacteria 15755
86 Ga0495638_0019050 3300046460 Bacteria 4544
87 Ga0495638_0019835 3300046460 Bacteria 4445
88 Ga0495638_0037116 3300046460 Bacteria 3101
89 Ga0495638_0043882 3300046460 Bacteria 2819
90 Ga0495650_0000024 3300046471 Bacteria 496674
91 Ga0495606_0145489 3300046507 Bacteria 1396
92 Ga0495610_0000478 3300046512 Bacteria 41250
93 Ga0495610_0002807 3300046512 Bacteria 14223
94 Ga0495610_0021569 3300046512 Bacteria 3539
95 Ga0495616_0000461 3300046513 Bacteria 30938
96 Ga0495620_0008525 3300046515 Bacteria 5498
97 Ga0495631_0025398 3300046518 Bacteria 2728
98 Ga0495632_0000761 3300046519 Bacteria 28951
99 Ga0495637_0038257 3300046520 Bacteria 2078
100 Ga0495643_0041566 3300046522 Bacteria 2506
101 Ga0495648_0000075 3300046524 Bacteria 129579
102 Ga0495648_0014079 3300046524 Bacteria 5877
103 Ga0495654_0000135 3300046530 Bacteria 77516
104 Ga0495654_0032808 3300046530 Bacteria 2631
105 Ga0495633_0000377 3300046558 Bacteria 47490
106 Ga0495633_0073364 3300046558 Bacteria 1595
107 Ga0495656_0038833 3300046615 Bacteria 1974
108 Ga0495668_0013615 3300046616 Bacteria 4790
109 Ga0495668_0069193 3300046616 Bacteria 1941
110 Ga0495625_0000283 3300046660 Bacteria 79056
111 Ga0495625_0017514 3300046660 Bacteria 5608
112 Ga0495625_0021286 3300046660 Bacteria 4995
113 Ga0495625_0073283 3300046660 Bacteria 2400
114 Ga0495671_0006246 3300046692 Bacteria 6902
115 Ga0495649_0061061 3300046694 Bacteria 2027
116 Ga0495589_0034115 3300046794 Bacteria 2555
117 Ga0495660_0007637 3300046810 Bacteria 6351
118 Ga0495672_0001076 3300047320 Bacteria 27816
119 Ga0495679_006836 3300047446 Bacteria 4848
120 Ga0495673_0000139 3300047469 Bacteria 130652
121 Ga0495673_0001293 3300047469 Bacteria 20448
122 Ga0495686_0000870 3300047472 Bacteria 38471
123 Ga0495626_0000034 3300048091 Bacteria 183391
124 Ga0496111_0020415 3300048914 Bacteria 4612
125 Ga0496116_0036437 3300048919 Bacteria 3442
126 Ga0496117_0000001 3300048920 Bacteria 2526244
127 Ga0496117_0040116 3300048920 Bacteria 3449
128 Ga0496118_0000002 3300048921 Bacteria 1690764
129 Ga0496118_0006607 3300048921 Bacteria 12661
130 Ga0496119_0032810 3300048922 Bacteria 3456
131 Ga0496121_0000852 3300048924 Bacteria 55246
132 Ga0496121_0022135 3300048924 Bacteria 6183
133 Ga0496122_0009104 3300048925 Bacteria 10526
134 Ga0496123_0007928 3300048926 Bacteria 9861
135 Ga0496124_0018635 3300048927 Bacteria 6494
136 Ga0496124_0115556 3300048927 Bacteria 2153
137 Ga0496125_0000313 3300048928 Bacteria 95423
138 Ga0496125_0014508 3300048928 Bacteria 7670
139 Ga0496125_0065141 3300048928 Bacteria 2890
140 Ga0496126_0005019 3300048929 Bacteria 15401
141 Ga0495678_000539 3300049459 Bacteria 36560
142 Ga0501031_0040512 3300049568 Bacteria 3042
143 Ga0501032_0010740 3300049569 Bacteria 6592
144 Ga0501033_0018607 3300049570 Bacteria 5250
145 Ga0501034_0151743 3300049571 Bacteria 2292
146 Ga0501046_0154408 3300049580 Bacteria 1730
147 Ga0501068_0044705 3300049584 Bacteria 2667
148 Ga0501238_004999 3300049671 Bacteria 1671
149 Ga0501081_0042824 3300049743 Bacteria 3104
150 Ga0501083_0105499 3300049744 Bacteria 1855
151 Ga0501035_0042113 3300049822 Bacteria 4120
152 Ga0501035_0099418 3300049822 Bacteria 2554
153 nmdc:mga00v17_128290_c1 3300050491 Bacteria 1619
154 nmdc:mga0k408_95115_c1 3300050493 Bacteria 1753
155 nmdc:mga07m45_31953_c1 3300050496 Bacteria 2918
156 nmdc:mga0qj67_46289_c1 3300050509 Bacteria 3434
157 nmdc:mga0sz30_3275_c1 3300050516 Bacteria 5819
158 Ga0500578_0000023 3300053086 Bacteria 153470
159 Ga0500643_000004 3300053087 Bacteria 857484
160 Ga0500643_000023 3300053087 Bacteria 273090
161 Ga0500641_0004183 3300053096 Bacteria 5094
162 Ga0500641_0026882 3300053096 Bacteria 2237
163 Ga0500555_006364 3300053103 Bacteria 3353
164 Ga0500556_0002388 3300053104 Bacteria 6066
165 Ga0500562_009485 3300053108 Bacteria 2458
166 Ga0500594_0000402 3300053118 Bacteria 9591
167 Ga0500608_000023 3300053122 Bacteria 72341
168 Ga0500618_000043 3300053125 Bacteria 110342
169 Ga0500559_0000327 3300053136 Bacteria 35827
170 Ga0500559_0005212 3300053136 Bacteria 5997
171 Ga0500564_000100 3300053138 Bacteria 22073
172 Ga0500568_0054497 3300053139 Bacteria 1564
173 Ga0500604_0009340 3300053151 Bacteria 2613
174 Ga0500622_0002724 3300053156 Bacteria 12478
175 Ga0500622_0018210 3300053156 Bacteria 3735
176 Ga0500622_0040265 3300053156 Bacteria 2433
177 Ga0500627_0045690 3300053158 Bacteria 1896
178 Ga0500645_005176 3300053730 Bacteria 4857
179 Ga0500645_035149 3300053730 Bacteria 1494
180 Ga0500609_000168 3300053731 Bacteria 9065
181 Ga0501084_0060471 3300054114 Bacteria 3172
182 Ga0501084_0252766 3300054114 Bacteria 1488
183 Ga0501082_0105651 3300060353 Bacteria 2436
184 Ga0501082_0176433 3300060353 Bacteria 1858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0032808 Ga0495654_0032808_217_1431 367
2 3300046558 Ga0495633_0000377 Ga0495633_0000377_25308_26531 370
3 3300017792 Ga0163161_10071257 Ga0163161_100712571 372
4 3300031711 Ga0265314_10012406 Ga0265314_100124064 372
5 3300048914 Ga0496111_0020415 Ga0496111_0020415_2948_4168 372
6 3300048927 Ga0496124_0115556 Ga0496124_0115556_320_1540 372
7 3300014497 Ga0182008_10000605 Ga0182008_1000060514 373
8 3300015261 Ga0182006_1000002 Ga0182006_1000002746 373
9 3300015262 Ga0182007_10000428 Ga0182007_1000042818 373
10 3300015265 Ga0182005_1000002 Ga0182005_1000002351 373
11 3300048919 Ga0496116_0036437 Ga0496116_0036437_1832_3055 373
12 3300048920 Ga0496117_0000001 Ga0496117_0000001_1263227_1264450 373
13 3300048921 Ga0496118_0000002 Ga0496118_0000002_1263227_1264450 373
14 3300048924 Ga0496121_0022135 Ga0496121_0022135_4350_5573 373
15 3300048925 Ga0496122_0009104 Ga0496122_0009104_4217_5440 373
16 3300048926 Ga0496123_0007928 Ga0496123_0007928_7447_8670 373
17 3300060353 Ga0501082_0176433 Ga0501082_0176433_616_1848 375
18 3300003323 rootH1_10285547 rootH1_102855473 376
19 3300049584 Ga0501068_0044705 Ga0501068_0044705_415_1587 377
20 3300054114 Ga0501084_0060471 Ga0501084_0060471_1455_2627 377
21 3300009093 Ga0105240_10181347 Ga0105240_101813472 378
22 3300025913 Ga0207695_10132524 Ga0207695_101325242 378
23 3300003794 Ga0055531_10031657 Ga0055531_100316572 382
24 3300025304 Ga0209257_1003061 Ga0209257_100306113 382
25 3300046558 Ga0495633_0073364 Ga0495633_0073364_384_1568 382
26 3300049743 Ga0501081_0042824 Ga0501081_0042824_150_1427 390
27 3300049568 Ga0501031_0040512 Ga0501031_0040512_165_1427 392
28 3300049569 Ga0501032_0010740 Ga0501032_0010740_2763_4028 392
29 3300049571 Ga0501034_0151743 Ga0501034_0151743_312_1574 392
30 3300049580 Ga0501046_0154408 Ga0501046_0154408_18_1280 392
31 3300049822 Ga0501035_0042113 Ga0501035_0042113_147_1415 392
32 3300009177 Ga0105248_10030807 Ga0105248_100308072 395
33 3300025941 Ga0207711_10016957 Ga0207711_100169575 395
34 3300048920 Ga0496117_0040116 Ga0496117_0040116_1013_2284 395
35 3300048921 Ga0496118_0006607 Ga0496118_0006607_7539_8810 395
36 3300048922 Ga0496119_0032810 Ga0496119_0032810_448_1719 395
37 3300048924 Ga0496121_0000852 Ga0496121_0000852_3986_5257 395
38 3300048928 Ga0496125_0014508 Ga0496125_0014508_2995_4302 395
39 3300048929 Ga0496126_0005019 Ga0496126_0005019_2728_4035 395
40 3300006353 Ga0075370_10015434 Ga0075370_100154342 400
41 3300050509 nmdc:mga0qj67_46289_c1 nmdc:mga0qj67_46289_c1_1570_2883 400
42 3300049570 Ga0501033_0018607 Ga0501033_0018607_3860_5077 401
43 3300049822 Ga0501035_0099418 Ga0501035_0099418_862_2079 401
44 3300050491 nmdc:mga00v17_128290_c1 nmdc:mga00v17_128290_c1_14_1270 401
45 3300053096 Ga0500641_0026882 Ga0500641_0026882_333_1589 401
46 3300006042 Ga0075368_10002727 Ga0075368_100027275 402
47 3300005459 Ga0068867_100245296 Ga0068867_1002452961 405
48 3300006881 Ga0068865_100211700 Ga0068865_1002117002 405
49 3300031456 Ga0307513_10095194 Ga0307513_100951943 405
50 3300031911 Ga0307412_10128161 Ga0307412_101281612 405
51 3300046692 Ga0495671_0006246 Ga0495671_0006246_4753_6024 405
52 3300048928 Ga0496125_0000313 Ga0496125_0000313_2169_3467 405
53 3300048928 Ga0496125_0065141 Ga0496125_0065141_1421_2668 405
54 3300003316 rootH1_10096795 rootH1_100967951 406
55 3300003781 Ga0055536_1002198 Ga0055536_10021986 406
56 3300003781 Ga0055536_1002641 Ga0055536_10026416 406
57 3300003791 Ga0055530_10004228 Ga0055530_100042282 406
58 3300003791 Ga0055530_10009897 Ga0055530_100098971 406
59 3300003794 Ga0055531_10002793 Ga0055531_100027936 406
60 3300006195 Ga0075366_10014085 Ga0075366_100140852 406
61 3300025292 Ga0209676_1000067 Ga0209676_1000067126 406
62 3300025292 Ga0209676_1000134 Ga0209676_1000134137 406
63 3300025298 Ga0209050_1000348 Ga0209050_100034832 406
64 3300025298 Ga0209050_1001208 Ga0209050_10012084 406
65 3300025299 Ga0209256_1014592 Ga0209256_10145922 406
66 3300025303 Ga0209051_1004010 Ga0209051_10040102 406
67 3300025304 Ga0209257_1000424 Ga0209257_100042428 406
68 3300025304 Ga0209257_1006524 Ga0209257_10065242 406
69 3300046460 Ga0495638_0000109 Ga0495638_0000109_84909_86276 406
70 3300046460 Ga0495638_0019835 Ga0495638_0019835_1772_3100 406
71 3300046460 Ga0495638_0043882 Ga0495638_0043882_714_2000 406
72 3300046512 Ga0495610_0002807 Ga0495610_0002807_2837_4219 406
73 3300046616 Ga0495668_0013615 Ga0495668_0013615_2110_3492 406
74 3300046660 Ga0495625_0017514 Ga0495625_0017514_1071_2357 406
75 3300046660 Ga0495625_0021286 Ga0495625_0021286_2080_3366 406
76 3300050493 nmdc:mga0k408_95115_c1 nmdc:mga0k408_95115_c1_451_1737 406
77 3300050496 nmdc:mga07m45_31953_c1 nmdc:mga07m45_31953_c1_595_1881 406
78 3300053122 Ga0500608_000023 Ga0500608_000023_25339_26625 406
79 3300053156 Ga0500622_0040265 Ga0500622_0040265_391_1677 406
80 iso_pu_bacteria 2585428106 2587916181 406
81 iso_pu_bacteria 2857504554 2857507472 406
82 iso_pu_bacteria 2928531327 2928534255 406
83 3300006846 Ga0075430_100049400 Ga0075430_1000494002 407
84 3300031238 Ga0265332_10000016 Ga0265332_10000016130 407
85 3300048927 Ga0496124_0018635 Ga0496124_0018635_2144_3436 407
86 3300050516 nmdc:mga0sz30_3275_c1 nmdc:mga0sz30_3275_c1_2211_3503 407
87 iso_pu_bacteria 2791355048 2792462811 407
88 iso_pu_bacteria 2843744320 2843746358 407
89 iso_pu_bacteria 2849560528 2849561932 407
90 iso_pu_bacteria 2849573788 2849575707 407
91 iso_pu_bacteria 2851153111 2851156297 407
92 iso_pu_bacteria 2898329390 2898331772 407
93 3300046460 Ga0495638_0000317 Ga0495638_0000317_37012_38358 408
94 3300053103 Ga0500555_006364 Ga0500555_006364_511_1791 408
95 3300053108 Ga0500562_009485 Ga0500562_009485_305_1591 408
96 3300003773 Ga0055537_1000432 Ga0055537_100043211 409
97 3300003775 Ga0055524_1015328 Ga0055524_10153282 409
98 3300005347 Ga0070668_100004405 Ga0070668_1000044055 409
99 3300005843 Ga0068860_100002126 Ga0068860_1000021265 409
100 3300005844 Ga0068862_100125637 Ga0068862_1001256372 409
101 3300025263 Ga0209565_1000491 Ga0209565_100049115 409
102 3300025273 Ga0209673_1001891 Ga0209673_100189110 409
103 3300025297 Ga0209758_1001122 Ga0209758_100112221 409
104 3300025299 Ga0209256_1001228 Ga0209256_100122820 409
105 3300025972 Ga0207668_10032252 Ga0207668_100322522 409
106 3300028380 Ga0268265_10004678 Ga0268265_100046784 409
107 3300028381 Ga0268264_10000113 Ga0268264_10000113204 409
108 3300031824 Ga0307413_10138353 Ga0307413_101383531 409
109 3300046457 Ga0495590_0021895 Ga0495590_0021895_28_1398 409
110 3300046518 Ga0495631_0025398 Ga0495631_0025398_1124_2494 409
111 3300047472 Ga0495686_0000870 Ga0495686_0000870_28329_29699 409
112 3300053136 Ga0500559_0000327 Ga0500559_0000327_28839_30203 409
113 3300053156 Ga0500622_0002724 Ga0500622_0002724_7882_9252 409
114 iso_pu_bacteria 2582581279 2585146082 409
115 3300049671 Ga0501238_004999 Ga0501238_004999_161_1477 410
116 3300053156 Ga0500622_0018210 Ga0500622_0018210_2369_3688 410
117 3300046524 Ga0495648_0000075 Ga0495648_0000075_94069_95442 411
118 3300047469 Ga0495673_0000139 Ga0495673_0000139_7901_9277 411
119 3300053087 Ga0500643_000004 Ga0500643_000004_445824_447068 411
120 3300053138 Ga0500564_000100 Ga0500564_000100_12830_14203 411
121 3300003775 Ga0055524_1000015 Ga0055524_1000015169 412
122 3300025295 Ga0209564_1027850 Ga0209564_10278501 412
123 3300025299 Ga0209256_1000005 Ga0209256_1000005170 412
124 3300046507 Ga0495606_0145489 Ga0495606_0145489_57_1361 412
125 3300046512 Ga0495610_0000478 Ga0495610_0000478_14695_16101 412
126 3300046522 Ga0495643_0041566 Ga0495643_0041566_719_2125 412
127 3300046616 Ga0495668_0069193 Ga0495668_0069193_595_1899 412
128 3300048091 Ga0495626_0000034 Ga0495626_0000034_27267_28550 412
129 3300049459 Ga0495678_000539 Ga0495678_000539_992_2386 412
130 3300053086 Ga0500578_0000023 Ga0500578_0000023_73923_75317 412
131 3300053118 Ga0500594_0000402 Ga0500594_0000402_1028_2422 412
132 iso_pu_bacteria 2643221640 2644227324 412
133 iso_pu_bacteria 2643221642 2644233208 412
134 3300006178 Ga0075367_10037941 Ga0075367_100379414 413
135 3300046460 Ga0495638_0019050 Ga0495638_0019050_2095_3501 413
136 3300047320 Ga0495672_0001076 Ga0495672_0001076_17872_19278 413
137 3300049744 Ga0501083_0105499 Ga0501083_0105499_80_1393 413
138 3300053136 Ga0500559_0005212 Ga0500559_0005212_2733_4097 413
139 3300054114 Ga0501084_0252766 Ga0501084_0252766_17_1330 413
140 3300060353 Ga0501082_0105651 Ga0501082_0105651_714_2027 413
141 3300003775 Ga0055524_1004011 Ga0055524_10040115 414
142 3300025295 Ga0209564_1007254 Ga0209564_10072542 414
143 3300025299 Ga0209256_1007649 Ga0209256_10076491 414
144 3300025304 Ga0209257_1000066 Ga0209257_1000066208 414
145 3300046460 Ga0495638_0002300 Ga0495638_0002300_11919_13265 414
146 3300046512 Ga0495610_0021569 Ga0495610_0021569_810_2156 414
147 3300046513 Ga0495616_0000461 Ga0495616_0000461_10519_11865 414
148 3300046810 Ga0495660_0007637 Ga0495660_0007637_55_1398 414
149 3300047446 Ga0495679_006836 Ga0495679_006836_2403_3794 414
150 3300053125 Ga0500618_000043 Ga0500618_000043_98197_99588 414
151 3300053731 Ga0500609_000168 Ga0500609_000168_2127_3473 414
152 iso_pu_bacteria 2547132512 2548847301 414
153 iso_pu_bacteria 2582581280 2585150606 414
154 iso_pu_bacteria 2582581293 2585198124 414
155 iso_pu_bacteria 2643221552 2643782760 414
156 iso_pu_bacteria 2643221583 2643924979 414
157 iso_pu_bacteria 2643221584 2643928069 414
158 iso_pu_bacteria 2818991435 2819538752 414
159 iso_pu_bacteria 2818991454 2819646714 414
160 3300005262 Ga0065165_1001159 Ga0065165_100115915 415
161 3300025295 Ga0209564_1000892 Ga0209564_100089236 415
162 3300025297 Ga0209758_1001524 Ga0209758_100152420 415
163 3300046519 Ga0495632_0000761 Ga0495632_0000761_14825_16174 415
164 3300053730 Ga0500645_035149 Ga0500645_035149_39_1325 415
165 iso_pu_bacteria 2861691609 2861692841 415
166 3300003771 Ga0055526_1000001 Ga0055526_1000001154 416
167 3300025295 Ga0209564_1000002 Ga0209564_1000002410 416
168 3300025298 Ga0209050_1015163 Ga0209050_10151632 416
169 3300046460 Ga0495638_0037116 Ga0495638_0037116_856_2124 416
170 3300003322 rootL2_10005826 rootL2_100058262 417
171 3300003323 rootH1_10007628 rootH1_1000762829 417
172 3300006038 Ga0075365_10016190 Ga0075365_100161904 417
173 3300042007 Ga0439449_0003249 Ga0439449_0003249_1966_3243 417
174 3300005548 Ga0070665_100213943 Ga0070665_1002139432 418
175 3300031548 Ga0307408_100001074 Ga0307408_10000107412 418
176 3300046520 Ga0495637_0038257 Ga0495637_0038257_127_1512 418
177 3300046615 Ga0495656_0038833 Ga0495656_0038833_113_1405 418
178 3300046794 Ga0495589_0034115 Ga0495589_0034115_1101_2393 418
179 3300047469 Ga0495673_0001293 Ga0495673_0001293_18902_20281 418
180 3300053104 Ga0500556_0002388 Ga0500556_0002388_2916_4301 418
181 3300053139 Ga0500568_0054497 Ga0500568_0054497_282_1553 418
182 3300053151 Ga0500604_0009340 Ga0500604_0009340_340_1632 418
183 3300053730 Ga0500645_005176 Ga0500645_005176_2609_3994 418
184 3300046660 Ga0495625_0000283 Ga0495625_0000283_4854_6236 419
185 3300053087 Ga0500643_000023 Ga0500643_000023_116696_118024 419
186 3300046471 Ga0495650_0000024 Ga0495650_0000024_103909_105300 420
187 3300046515 Ga0495620_0008525 Ga0495620_0008525_930_2321 420
188 3300046524 Ga0495648_0014079 Ga0495648_0014079_2273_3664 420
189 3300046530 Ga0495654_0000135 Ga0495654_0000135_35601_36992 420
190 3300046660 Ga0495625_0073283 Ga0495625_0073283_409_1791 420
191 3300053158 Ga0500627_0045690 Ga0500627_0045690_210_1601 420
192 iso_pu_bacteria 2643221545 2643747350 420
193 iso_pu_bacteria 2643221691 2644507451 420
194 3300031731 Ga0307405_10071943 Ga0307405_100719431 423
195 3300046694 Ga0495649_0061061 Ga0495649_0061061_617_1909 423
196 3300053096 Ga0500641_0004183 Ga0500641_0004183_3236_4528 423
197 3300005548 Ga0070665_100016270 Ga0070665_1000162702 424
198 3300028379 Ga0268266_10004709 Ga0268266_100047098 424
199 3300028794 Ga0307515_10014761 Ga0307515_1001476111 425
200 3300003187 JGI25151J46595_10014607 JGI25151J46595_100146071 433
201 3300003771 Ga0055526_1013264 Ga0055526_10132642 433
202 3300003775 Ga0055524_1000586 Ga0055524_100058613 433
203 3300025263 Ga0209565_1000077 Ga0209565_10000777 433
204 3300025294 Ga0209025_1000231 Ga0209025_1000231121 433
205 3300025295 Ga0209564_1000274 Ga0209564_10002747 433
206 3300025299 Ga0209256_1000119 Ga0209256_10001197 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03929

PepSY_TM

PepSY-associated TM region

47

440

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7abw-assembly1.cif.gz_A crystal structure of siderophore reductase foxb 0.8613 1 415
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.8599 1 416
7abw-assembly1.cif.gz_A crystal structure of siderophore reductase foxb 0.8568 1 415
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.8491 1 416
5boi-assembly1.cif.gz_A bacillus megaterium ypeb c-terminal domain 0.6352 284 358
ID Description Score Start End Superfamily
af_Q6ZNJ1_2433_2600_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8287 315 363 2.40.128.630
af_I1MSP8_372_716_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7807 315 357 2.130.10.10
af_Q75L87_1_294_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6629 152 265 1.20.140.150
af_A0A1D6HJ48_5_256_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6563 157 266 1.20.140.150
af_Q9VLH0_1_110_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6481 154 266 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A1G7FDU5-F1-model_v4 Uncharacterized iron-regulated membrane protein 0.9067 8 411 GO:0016020
AF-A0A4V1U6M8-F1-model_v4 deleted 0.9052 229 433
AF-A0A519M4Y2-F1-model_v4 PepSY domain-containing protein 0.8995 229 420 GO:0016020
AF-A0A4S4A8M4-F1-model_v4 PepSY domain-containing protein 0.8928 1 413 GO:0016020
AF-A0A4V1U6M8-F1-model_v4 deleted 0.8926 229 433

Feature Viewer

pLDDT pTM Quality
84.2 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map