F315355

General Info

Members Datasets Scaffolds Average Seq Length
206 141 412 259

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0042773|Ga0373955_0042773_416_1243
Length 275
Sequence VRFTLPNKKGTWMIRALYSAASGMTAQEMSIDNIANNLANANTVGFKSRRTQFQDLLYQSFLQPGTAAGSQTVVPSGLQLGLGTRPAANTIVFTQGNFQQTDNPLDLVIQGKGFFQIRRTTGDIAYTRAGNFQLDRDGNVVTGSGDPIEPQITIPAQATAVNIASDGTVSYTQPGQTAAQVAGQIQLAGFTNPGGLNAIGSGLFLQTDASGDPTVGNPGGQEGLGSLQQGYVEASNVSVVEEFINMIMAQRTYEASSKVVKAADEMYSTVNNLTQ

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
66 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 0
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 16.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0042773 3300035172 Bacteria 2434
2 Ga0070680_100089592 3300005336 Bacteria 2546
3 Ga0070660_100629567 3300005339 Bacteria 898
4 Ga0070661_100056289 3300005344 Bacteria 2881
5 Ga0070709_10042713 3300005434 Unclassified 2801
6 Ga0070709_10303742 3300005434 Bacteria 1166
7 Ga0070714_100002823 3300005435 Bacteria 12815
8 Ga0070713_100000850 3300005436 Bacteria 19589
9 Ga0070713_100048693 3300005436 Bacteria 3492
10 Ga0070706_100400171 3300005467 Bacteria 1278
11 Ga0070699_100280205 3300005518 Bacteria 1493
12 Ga0070679_100119649 3300005530 Bacteria 2618
13 Ga0070704_100106910 3300005549 Bacteria 2121
14 Ga0068859_100057115 3300005617 Bacteria 3931
15 Ga0070717_10015318 3300006028 Bacteria 5920
16 Ga0070717_10020897 3300006028 Bacteria 5154
17 Ga0070717_10030517 3300006028 Unclassified 4331
18 Ga0070717_10615180 3300006028 Bacteria 985
19 Ga0097621_100838830 3300006237 Bacteria 853
20 Ga0075430_100015100 3300006846 Bacteria 6574
21 Ga0075433_10173407 3300006852 Bacteria 1919
22 Ga0075436_100050149 3300006914 Unclassified 2880
23 Ga0097620_100057115 3300006931 Bacteria 3931
24 Ga0105240_10007638 3300009093 Bacteria 15662
25 Ga0105242_10267515 3300009176 Bacteria 1547
26 Ga0105242_10652833 3300009176 Bacteria 1023
27 Ga0105248_10044189 3300009177 Bacteria 4997
28 Ga0105248_10053651 3300009177 Bacteria 4523
29 Ga0105248_10088049 3300009177 Bacteria 3495
30 Ga0105248_10136907 3300009177 Bacteria 2763
31 Ga0105237_10036127 3300009545 Bacteria 4999
32 Ga0105238_10099170 3300009551 Bacteria 2896
33 Ga0105249_10733426 3300009553 Bacteria 1049
34 Ga0105239_10778526 3300010375 Bacteria 1096
35 Ga0157373_10334221 3300013100 Bacteria 1079
36 Ga0157370_10013119 3300013104 Bacteria 8550
37 Ga0157370_10079568 3300013104 Bacteria 3086
38 Ga0157369_10096691 3300013105 Bacteria 3150
39 Ga0157369_10412544 3300013105 Bacteria 1400
40 Ga0157378_10116444 3300013297 Bacteria 2457
41 Ga0157380_10467437 3300014326 Bacteria 1216
42 Ga0213874_10048294 3300021377 Bacteria 1298
43 Ga0213871_10000038 3300021441 Bacteria 9576
44 Ga0213871_10055765 3300021441 Bacteria 1092
45 Ga0207699_10276291 3300025906 Bacteria 1166
46 Ga0207699_10314240 3300025906 Unclassified 1097
47 Ga0207705_10300124 3300025909 Bacteria 1232
48 Ga0207684_10336549 3300025910 Bacteria 1300
49 Ga0207695_10190989 3300025913 Bacteria 1966
50 Ga0207660_10075780 3300025917 Bacteria 2458
51 Ga0207652_10116680 3300025921 Bacteria 2372
52 Ga0207652_10472818 3300025921 Bacteria 1129
53 Ga0207687_10397402 3300025927 Bacteria 1133
54 Ga0207700_10000804 3300025928 Bacteria 18112
55 Ga0207686_10376297 3300025934 Bacteria 1076
56 Ga0207711_10021725 3300025941 Bacteria 5361
57 Ga0207711_10176439 3300025941 Bacteria 1941
58 Ga0207661_10193787 3300025944 Bacteria 1783
59 Ga0207712_10087475 3300025961 Unclassified 2285
60 Ga0207703_10036874 3300026035 Bacteria 3894
61 Ga0207641_10043305 3300026088 Bacteria 3780
62 Ga0265338_10015096 3300028800 Bacteria 8522
63 Ga0265330_10018266 3300031235 Bacteria 3221
64 Ga0265332_10034472 3300031238 Bacteria 2199
65 Ga0265328_10079684 3300031239 Unclassified 1207
66 Ga0265320_10000164 3300031240 Bacteria 55580
67 Ga0265325_10011193 3300031241 Bacteria 5163
68 Ga0265325_10084369 3300031241 Bacteria 1575
69 Ga0265325_10205119 3300031241 Unclassified 907
70 Ga0265329_10005502 3300031242 Bacteria 5111
71 Ga0265340_10005151 3300031247 Bacteria 7270
72 Ga0265339_10059980 3300031249 Unclassified 2051
73 Ga0265331_10006015 3300031250 Bacteria 7235
74 Ga0265316_10002790 3300031344 Bacteria 17907
75 Ga0265316_10038510 3300031344 Bacteria 3851
76 Ga0316575_10011920 3300031665 Bacteria 3225
77 Ga0316579_10033962 3300031691 Bacteria 2344
78 Ga0316579_10198542 3300031691 Bacteria 970
79 Ga0265314_10005287 3300031711 Bacteria 11686
80 Ga0265314_10024747 3300031711 Bacteria 4545
81 Ga0265314_10045318 3300031711 Unclassified 3110
82 Ga0265342_10019051 3300031712 Bacteria 4430
83 Ga0316576_10082603 3300031727 Bacteria 2385
84 Ga0316576_10142863 3300031727 Bacteria 1802
85 Ga0316576_10200282 3300031727 Bacteria 1504
86 Ga0316578_10020527 3300031728 Bacteria 3652
87 Ga0316578_10068767 3300031728 Bacteria 2094
88 Ga0316583_10068528 3300032133 Bacteria 1241
89 Ga0316585_10024879 3300032137 Bacteria 1854
90 Ga0316580_10053816 3300032139 Bacteria 1238
91 Ga0373954_0005031 3300035118 Bacteria 5705
92 Ga0373954_0049935 3300035118 Bacteria 1962
93 Ga0373956_0109448 3300035119 Unclassified 1285
94 Ga0373943_0015435 3300035170 Bacteria 3469
95 Ga0373955_0053373 3300035172 Unclassified 2207
96 Ga0316574_0014679 3300035398 Bacteria 4531
97 Ga0373935_0097046 3300035692 Bacteria 1938
98 Ga0373935_0118453 3300035692 Unclassified 1766
99 Ga0373927_0000335 3300035695 Bacteria 36911
100 Ga0373927_0001372 3300035695 Bacteria 18341
101 Ga0373927_0007877 3300035695 Bacteria 7206
102 Ga0373927_0099308 3300035695 Unclassified 1893
103 Ga0373927_0158426 3300035695 Bacteria 1483
104 Ga0373933_0041026 3300035724 Unclassified 2730
105 Ga0373933_0073385 3300035724 Bacteria 2085
106 Ga0373933_0495723 3300035724 Bacteria 800
107 Ga0373947_0009737 3300035725 Bacteria 5515
108 Ga0373947_0142186 3300035725 Bacteria 1540
109 Ga0373947_0166921 3300035725 Unclassified 1426
110 Ga0373937_0023056 3300036401 Bacteria 5601
111 Ga0373937_0050908 3300036401 Bacteria 3796
112 Ga0373937_0841188 3300036401 Bacteria 866
113 Ga0316582_0071971 3300036647 Bacteria 2240
114 Ga0316584_0004572 3300036712 Bacteria 9170
115 Ga0316584_0066197 3300036712 Bacteria 2707
116 Ga0373925_0022056 3300037068 Bacteria 4641
117 Ga0395900_0146903 3300037418 Unclassified 2411
118 Ga0395898_0046541 3300037466 Unclassified 4262
119 Ga0436364_0748068 3300037853 Bacteria 528910
120 Ga0436364_1517816 3300037853 Bacteria 3659
121 Ga0400490_06559 3300038726 Bacteria 17425
122 Ga0436360_0298167 3300039438 Unclassified 1304
123 Ga0436360_0677684 3300039438 Bacteria 2137
124 Ga0436360_0693367 3300039438 Bacteria 21687
125 Ga0436363_0441113 3300039450 Bacteria 1663
126 Ga0436362_1038448 3300039453 Unclassified 1714
127 Ga0451577_0467947 3300042876 Unclassified 1145
128 Ga0453684_0275235 3300044712 Unclassified 1922
129 Ga0451576_0480615 3300045051 Bacteria 1305
130 Ga0451576_0719034 3300045051 Unclassified 1049
131 Ga0495592_0021881 3300046454 Bacteria 4865
132 Ga0495651_0003888 3300046462 Bacteria 11425
133 Ga0495651_0073659 3300046462 Unclassified 2592
134 Ga0495651_0393950 3300046462 Bacteria 906
135 Ga0495580_0003752 3300046472 Bacteria 12863
136 Ga0495580_0032135 3300046472 Unclassified 3789
137 Ga0495580_0070331 3300046472 Bacteria 2445
138 Ga0495580_0495538 3300046472 Unclassified 816
139 Ga0495664_0001592 3300046477 Bacteria 12047
140 Ga0495664_0078081 3300046477 Bacteria 1983
141 Ga0495652_0029058 3300046529 Bacteria 4857
142 Ga0495640_0021537 3300046533 Bacteria 4729
143 Ga0495640_0326986 3300046533 Bacteria 949
144 Ga0495645_0006550 3300046543 Bacteria 8089
145 Ga0495667_0039663 3300046559 Bacteria 3130
146 Ga0495667_0234788 3300046559 Bacteria 1169
147 Ga0495635_0010404 3300046663 Bacteria 6506
148 Ga0495657_0065300 3300046675 Bacteria 2394
149 Ga0495599_0002828 3300046678 Bacteria 10110
150 Ga0495646_0026492 3300046680 Bacteria 3641
151 Ga0495613_0022402 3300046689 Bacteria 4708
152 Ga0495613_0120851 3300046689 Unclassified 1881
153 Ga0495600_0151519 3300046809 Bacteria 1501
154 Ga0495604_0037513 3300047317 Bacteria 3816
155 Ga0495674_0033352 3300047319 Bacteria 4665
156 Ga0495674_0057830 3300047319 Bacteria 3393
157 Ga0495674_0066136 3300047319 Bacteria 3138
158 Ga0495674_0171349 3300047319 Bacteria 1811
159 Ga0495680_0020918 3300047322 Bacteria 5489
160 Ga0495684_0058910 3300047471 Bacteria 2925
161 Ga0495684_0195144 3300047471 Bacteria 1495
162 Ga0496126_0098068 3300048929 Unclassified 2568
163 Ga0501031_0001845 3300049568 Bacteria 13328
164 Ga0501031_0405929 3300049568 Unclassified 881
165 Ga0501032_0002395 3300049569 Bacteria 14612
166 Ga0501033_0115073 3300049570 Bacteria 1954
167 Ga0501034_0006576 3300049571 Bacteria 12474
168 Ga0501036_0001747 3300049572 Bacteria 16878
169 Ga0501037_0002581 3300049573 Bacteria 13083
170 Ga0501038_0003867 3300049574 Bacteria 13917
171 Ga0501040_0260662 3300049576 Bacteria 1237
172 Ga0501042_0066367 3300049578 Bacteria 2579
173 Ga0501043_0008753 3300049579 Bacteria 7968
174 Ga0501046_0003269 3300049580 Bacteria 14878
175 Ga0501046_0339399 3300049580 Bacteria 1092
176 Ga0501047_0028328 3300049581 Bacteria 5399
177 Ga0501047_0061389 3300049581 Bacteria 3627
178 Ga0501048_0048651 3300049582 Bacteria 3023
179 Ga0501067_0005449 3300049583 Bacteria 7062
180 Ga0501068_0000882 3300049584 Bacteria 15647
181 Ga0501069_0006760 3300049585 Bacteria 6005
182 Ga0501070_0032698 3300049586 Bacteria 4353
183 Ga0501070_0505929 3300049586 Unclassified 970
184 Ga0501072_0001758 3300049588 Bacteria 16112
185 Ga0501073_0001707 3300049589 Bacteria 16292
186 Ga0501074_0016278 3300049590 Bacteria 5399
187 Ga0501079_0003012 3300049741 Bacteria 12321
188 Ga0501080_0000243 3300049742 Bacteria 40903
189 Ga0501083_0004841 3300049744 Bacteria 9512
190 Ga0501035_0012772 3300049822 Bacteria 7757
191 Ga0501035_0069628 3300049822 Unclassified 3118
192 Ga0501044_0001789 3300049823 Bacteria 25105
193 Ga0501044_0005469 3300049823 Bacteria 14107
194 Ga0501044_0053380 3300049823 Bacteria 4158
195 Ga0501044_0188218 3300049823 Bacteria 2028
196 Ga0501044_0307376 3300049823 Bacteria 1513
197 Ga0501045_0101033 3300049824 Bacteria 2135
198 nmdc:mga0qj67_77237_c1 3300050509 Unclassified 2664
199 nmdc:mga06r32_11326_c1 3300050510 Bacteria 8032
200 nmdc:mga0rr50_737254_c1 3300050513 Unclassified 841
201 nmdc:mga08x19_124100_c1 3300050514 Unclassified 1733
202 nmdc:mga08x19_61464_c1 3300050514 Unclassified 2434
203 Ga0500568_0000551 3300053139 Bacteria 27571
204 Ga0501084_0001914 3300054114 Bacteria 16614
205 Ga0587077_045117 3300059493 Unclassified 900
206 Ga0501082_0008234 3300060353 Bacteria 8990
207 Ga0373955_0042773
208 Ga0070680_100089592
209 Ga0070660_100629567
210 Ga0070661_100056289
211 Ga0070709_10042713
212 Ga0070709_10303742
213 Ga0070714_100002823
214 Ga0070713_100000850
215 Ga0070713_100048693
216 Ga0070706_100400171
217 Ga0070699_100280205
218 Ga0070679_100119649
219 Ga0070704_100106910
220 Ga0068859_100057115
221 Ga0070717_10015318
222 Ga0070717_10020897
223 Ga0070717_10030517
224 Ga0070717_10615180
225 Ga0097621_100838830
226 Ga0075430_100015100
227 Ga0075433_10173407
228 Ga0075436_100050149
229 Ga0097620_100057115
230 Ga0105240_10007638
231 Ga0105242_10267515
232 Ga0105242_10652833
233 Ga0105248_10044189
234 Ga0105248_10053651
235 Ga0105248_10088049
236 Ga0105248_10136907
237 Ga0105237_10036127
238 Ga0105238_10099170
239 Ga0105249_10733426
240 Ga0105239_10778526
241 Ga0157373_10334221
242 Ga0157370_10013119
243 Ga0157370_10079568
244 Ga0157369_10096691
245 Ga0157369_10412544
246 Ga0157378_10116444
247 Ga0157380_10467437
248 Ga0213874_10048294
249 Ga0213871_10000038
250 Ga0213871_10055765
251 Ga0207699_10276291
252 Ga0207699_10314240
253 Ga0207705_10300124
254 Ga0207684_10336549
255 Ga0207695_10190989
256 Ga0207660_10075780
257 Ga0207652_10116680
258 Ga0207652_10472818
259 Ga0207687_10397402
260 Ga0207700_10000804
261 Ga0207686_10376297
262 Ga0207711_10021725
263 Ga0207711_10176439
264 Ga0207661_10193787
265 Ga0207712_10087475
266 Ga0207703_10036874
267 Ga0207641_10043305
268 Ga0265338_10015096
269 Ga0265330_10018266
270 Ga0265332_10034472
271 Ga0265328_10079684
272 Ga0265320_10000164
273 Ga0265325_10011193
274 Ga0265325_10084369
275 Ga0265325_10205119
276 Ga0265329_10005502
277 Ga0265340_10005151
278 Ga0265339_10059980
279 Ga0265331_10006015
280 Ga0265316_10002790
281 Ga0265316_10038510
282 Ga0316575_10011920
283 Ga0316579_10033962
284 Ga0316579_10198542
285 Ga0265314_10005287
286 Ga0265314_10024747
287 Ga0265314_10045318
288 Ga0265342_10019051
289 Ga0316576_10082603
290 Ga0316576_10142863
291 Ga0316576_10200282
292 Ga0316578_10020527
293 Ga0316578_10068767
294 Ga0316583_10068528
295 Ga0316585_10024879
296 Ga0316580_10053816
297 Ga0373954_0005031
298 Ga0373954_0049935
299 Ga0373956_0109448
300 Ga0373943_0015435
301 Ga0373955_0053373
302 Ga0316574_0014679
303 Ga0373935_0097046
304 Ga0373935_0118453
305 Ga0373927_0000335
306 Ga0373927_0001372
307 Ga0373927_0007877
308 Ga0373927_0099308
309 Ga0373927_0158426
310 Ga0373933_0041026
311 Ga0373933_0073385
312 Ga0373933_0495723
313 Ga0373947_0009737
314 Ga0373947_0142186
315 Ga0373947_0166921
316 Ga0373937_0023056
317 Ga0373937_0050908
318 Ga0373937_0841188
319 Ga0316582_0071971
320 Ga0316584_0004572
321 Ga0316584_0066197
322 Ga0373925_0022056
323 Ga0395900_0146903
324 Ga0395898_0046541
325 Ga0436364_0748068
326 Ga0436364_1517816
327 Ga0400490_06559
328 Ga0436360_0298167
329 Ga0436360_0677684
330 Ga0436360_0693367
331 Ga0436363_0441113
332 Ga0436362_1038448
333 Ga0451577_0467947
334 Ga0453684_0275235
335 Ga0451576_0480615
336 Ga0451576_0719034
337 Ga0495592_0021881
338 Ga0495651_0003888
339 Ga0495651_0073659
340 Ga0495651_0393950
341 Ga0495580_0003752
342 Ga0495580_0032135
343 Ga0495580_0070331
344 Ga0495580_0495538
345 Ga0495664_0001592
346 Ga0495664_0078081
347 Ga0495652_0029058
348 Ga0495640_0021537
349 Ga0495640_0326986
350 Ga0495645_0006550
351 Ga0495667_0039663
352 Ga0495667_0234788
353 Ga0495635_0010404
354 Ga0495657_0065300
355 Ga0495599_0002828
356 Ga0495646_0026492
357 Ga0495613_0022402
358 Ga0495613_0120851
359 Ga0495600_0151519
360 Ga0495604_0037513
361 Ga0495674_0033352
362 Ga0495674_0057830
363 Ga0495674_0066136
364 Ga0495674_0171349
365 Ga0495680_0020918
366 Ga0495684_0058910
367 Ga0495684_0195144
368 Ga0496126_0098068
369 Ga0501031_0001845
370 Ga0501031_0405929
371 Ga0501032_0002395
372 Ga0501033_0115073
373 Ga0501034_0006576
374 Ga0501036_0001747
375 Ga0501037_0002581
376 Ga0501038_0003867
377 Ga0501040_0260662
378 Ga0501042_0066367
379 Ga0501043_0008753
380 Ga0501046_0003269
381 Ga0501046_0339399
382 Ga0501047_0028328
383 Ga0501047_0061389
384 Ga0501048_0048651
385 Ga0501067_0005449
386 Ga0501068_0000882
387 Ga0501069_0006760
388 Ga0501070_0032698
389 Ga0501070_0505929
390 Ga0501072_0001758
391 Ga0501073_0001707
392 Ga0501074_0016278
393 Ga0501079_0003012
394 Ga0501080_0000243
395 Ga0501083_0004841
396 Ga0501035_0012772
397 Ga0501035_0069628
398 Ga0501044_0001789
399 Ga0501044_0005469
400 Ga0501044_0053380
401 Ga0501044_0188218
402 Ga0501044_0307376
403 Ga0501045_0101033
404 nmdc:mga0qj67_77237_c1
405 nmdc:mga06r32_11326_c1
406 nmdc:mga0rr50_737254_c1
407 nmdc:mga08x19_124100_c1
408 nmdc:mga08x19_61464_c1
409 Ga0500568_0000551
410 Ga0501084_0001914
411 Ga0587077_045117
412 Ga0501082_0008234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

17

47

0.99

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

228

273

0.98

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

108

171

0.98

Map