F315197

General Info

Members Datasets Scaffolds Average Seq Length
206 147 412 106

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10155331|Ga0207654_101553312
Length 119
Sequence MTTKNPAELNGTKRSTTSRENGEGDFNLRLYVAGQTPKSLAAIANLKMLCEDHLAGRYTIEVIDLLVKPQLAAGDQIVAIPTLIRKVPVPIRKIIGDLSDEEKVLVGLNIRPLPSKNKP

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
105 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
106 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
117 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
118 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
119 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
120 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
121 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
122 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
123 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
140 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
145 2738541278 Niastella sp. CF465 Isolate Unclassified
146 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
147 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.14
Nodule 0
Rhizoplane 1.94
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 26.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10155331 3300025911 Bacteria 1473
2 MRS1b_contig_4113148 2162886011 Bacteria 1821
3 rootH2_10022652 3300003320 Bacteria 10825
4 rootH2_10098791 3300003320 Bacteria 1809
5 Ga0055535_1001043 3300003761 Bacteria 17428
6 Ga0055531_10000063 3300003794 Bacteria 119938
7 Ga0065704_10107730 3300005289 Bacteria 2048
8 Ga0065712_10013783 3300005290 Bacteria 2138
9 Ga0070658_10236430 3300005327 Bacteria 1548
10 Ga0070670_101137207 3300005331 Bacteria 713
11 Ga0070670_101834127 3300005331 Unclassified 558
12 Ga0070670_101968789 3300005331 Bacteria 538
13 Ga0070677_10068542 3300005333 Bacteria 1485
14 Ga0070677_10800022 3300005333 Bacteria 538
15 Ga0070689_101606578 3300005340 Bacteria 590
16 Ga0070661_100220271 3300005344 Bacteria 1455
17 Ga0070668_100437655 3300005347 Bacteria 1122
18 Ga0070669_100174873 3300005353 Bacteria 1676
19 Ga0070669_101049287 3300005353 Bacteria 701
20 Ga0070669_101052716 3300005353 Bacteria 699
21 Ga0070675_100042595 3300005354 Unclassified 3710
22 Ga0070675_100094506 3300005354 Unclassified 2509
23 Ga0070671_100129287 3300005355 Unclassified 2127
24 Ga0070674_100048242 3300005356 Bacteria 2922
25 Ga0070659_100443356 3300005366 Unclassified 1100
26 Ga0070667_100350633 3300005367 Bacteria 1336
27 Ga0070711_100402482 3300005439 Bacteria 1111
28 Ga0070678_101998860 3300005456 Bacteria 548
29 Ga0070662_100731792 3300005457 Bacteria 838
30 Ga0070681_10101248 3300005458 Bacteria 2826
31 Ga0070681_11020606 3300005458 Bacteria 747
32 Ga0068867_100869609 3300005459 Bacteria 809
33 Ga0070685_10380457 3300005466 Bacteria 972
34 Ga0070679_100018575 3300005530 Bacteria 6749
35 Ga0068853_100018132 3300005539 Bacteria 5821
36 Ga0068853_100042566 3300005539 Unclassified 3884
37 Ga0070672_100129272 3300005543 Unclassified 2075
38 Ga0070665_100009493 3300005548 Bacteria 9839
39 Ga0070704_101267001 3300005549 Bacteria 674
40 Ga0068855_100011432 3300005563 Bacteria 10723
41 Ga0068855_101405223 3300005563 Unclassified 719
42 Ga0070664_100003530 3300005564 Bacteria 12624
43 Ga0068857_100000786 3300005577 Bacteria 23700
44 Ga0068857_102117636 3300005577 Unclassified 552
45 Ga0068854_100004997 3300005578 Bacteria 8363
46 Ga0068856_100090257 3300005614 Unclassified 3048
47 Ga0068852_100024479 3300005616 Unclassified 4880
48 Ga0068852_100256455 3300005616 Bacteria 1677
49 Ga0068852_100271253 3300005616 Bacteria 1633
50 Ga0068866_10789155 3300005718 Bacteria 659
51 Ga0068861_101176895 3300005719 Bacteria 740
52 Ga0068851_10010658 3300005834 Bacteria 4293
53 Ga0068870_10175794 3300005840 Bacteria 1281
54 Ga0068870_11022229 3300005840 Bacteria 590
55 Ga0068862_101396854 3300005844 Bacteria 703
56 Ga0068862_102493197 3300005844 Bacteria 529
57 Ga0097621_100464335 3300006237 Bacteria 1142
58 Ga0097621_101543775 3300006237 Unclassified 631
59 Ga0075428_100005930 3300006844 Bacteria 13580
60 Ga0075429_100014192 3300006880 Bacteria 6905
61 Ga0105240_10007620 3300009093 Bacteria 15676
62 Ga0105240_10079581 3300009093 Bacteria 4033
63 Ga0105240_10740248 3300009093 Bacteria 1070
64 Ga0111539_10153043 3300009094 Bacteria 2699
65 Ga0105241_10104156 3300009174 Bacteria 2260
66 Ga0105241_10169918 3300009174 Unclassified 1800
67 Ga0105242_10101797 3300009176 Unclassified 2435
68 Ga0105242_10657722 3300009176 Bacteria 1020
69 Ga0105248_12703008 3300009177 Bacteria 566
70 Ga0105237_10007625 3300009545 Bacteria 11828
71 Ga0105237_10030800 3300009545 Bacteria 5446
72 Ga0105237_10149906 3300009545 Unclassified 2328
73 Ga0105237_10421956 3300009545 Unclassified 1339
74 Ga0105238_10001145 3300009551 Bacteria 26746
75 Ga0105238_10627468 3300009551 Unclassified 1084
76 Ga0105249_13332320 3300009553 Unclassified 517
77 Ga0105239_10186740 3300010375 Bacteria 2320
78 Ga0157373_10042020 3300013100 Unclassified 3268
79 Ga0157373_10166302 3300013100 Bacteria 1552
80 Ga0157371_10028413 3300013102 Bacteria 4051
81 Ga0157371_10033035 3300013102 Bacteria 3720
82 Ga0157371_10325789 3300013102 Bacteria 1115
83 Ga0157371_10344230 3300013102 Bacteria 1085
84 Ga0157369_10061206 3300013105 Unclassified 4059
85 Ga0157369_10190351 3300013105 Bacteria 2156
86 Ga0157374_10093133 3300013296 Bacteria 2876
87 Ga0157374_10639529 3300013296 Unclassified 1075
88 Ga0163162_11927384 3300013306 Bacteria 677
89 Ga0157372_10000231 3300013307 Bacteria 62248
90 Ga0157372_10101925 3300013307 Bacteria 3278
91 Ga0157372_10427016 3300013307 Bacteria 1545
92 Ga0157372_11287447 3300013307 Unclassified 844
93 Ga0157372_12694307 3300013307 Unclassified 570
94 Ga0157375_10319752 3300013308 Unclassified 1716
95 Ga0163163_10854030 3300014325 Bacteria 974
96 Ga0163163_13051145 3300014325 Unclassified 522
97 Ga0157380_10272582 3300014326 Bacteria 1544
98 Ga0157377_10021039 3300014745 Unclassified 3426
99 Ga0157377_10593308 3300014745 Unclassified 789
100 Ga0157376_11645251 3300014969 Bacteria 677
101 Ga0209258_100252 3300025242 Bacteria 97179
102 Ga0209258_109426 3300025242 Bacteria 1313
103 Ga0209148_1000217 3300025254 Bacteria 98076
104 Ga0209758_1050966 3300025297 Bacteria 1446
105 Ga0209257_1000008 3300025304 Bacteria 1294570
106 Ga0207656_10026830 3300025321 Bacteria 2352
107 Ga0207682_10245984 3300025893 Bacteria 832
108 Ga0207680_10443578 3300025903 Bacteria 921
109 Ga0207647_10008370 3300025904 Bacteria 7420
110 Ga0207647_10011395 3300025904 Bacteria 6235
111 Ga0207643_10192943 3300025908 Bacteria 1237
112 Ga0207654_10065809 3300025911 Bacteria 2135
113 Ga0207707_10148680 3300025912 Bacteria 2048
114 Ga0207695_10041120 3300025913 Bacteria 4949
115 Ga0207695_10044591 3300025913 Bacteria 4715
116 Ga0207695_10173173 3300025913 Unclassified 2083
117 Ga0207671_10000468 3300025914 Bacteria 55019
118 Ga0207671_10018649 3300025914 Bacteria 5317
119 Ga0207694_10004084 3300025924 Bacteria 11478
120 Ga0207694_10443140 3300025924 Unclassified 1084
121 Ga0207694_10736184 3300025924 Unclassified 832
122 Ga0207650_11638909 3300025925 Unclassified 546
123 Ga0207659_10057317 3300025926 Bacteria 2793
124 Ga0207659_10061915 3300025926 Unclassified 2699
125 Ga0207686_11352781 3300025934 Bacteria 585
126 Ga0207691_10024905 3300025940 Bacteria 5623
127 Ga0207661_10113605 3300025944 Bacteria 2295
128 Ga0207661_10434499 3300025944 Bacteria 1194
129 Ga0207667_10000100 3300025949 Bacteria 138482
130 Ga0207667_11082113 3300025949 Unclassified 786
131 Ga0207640_10003587 3300025981 Bacteria 8365
132 Ga0207639_10046889 3300026041 Unclassified 3263
133 Ga0207639_10053099 3300026041 Bacteria 3090
134 Ga0207702_10926703 3300026078 Unclassified 863
135 Ga0207648_10129609 3300026089 Unclassified 2220
136 Ga0207648_11527725 3300026089 Bacteria 628
137 Ga0207674_10002387 3300026116 Bacteria 23735
138 Ga0207674_11871696 3300026116 Bacteria 566
139 Ga0207683_11002211 3300026121 Bacteria 775
140 Ga0207698_10001588 3300026142 Bacteria 13251
141 Ga0207698_10244502 3300026142 Unclassified 1638
142 Ga0207698_10316741 3300026142 Bacteria 1459
143 Ga0268266_10004680 3300028379 Bacteria 13031
144 Ga0268265_10284529 3300028380 Bacteria 1481
145 Ga0307509_10461403 3300031507 Bacteria 962
146 Ga0307405_10170523 3300031731 Bacteria 1552
147 Ga0307413_11321901 3300031824 Bacteria 631
148 Ga0307413_11883096 3300031824 Bacteria 537
149 Ga0307406_11011458 3300031901 Bacteria 714
150 Ga0307409_100907344 3300031995 Bacteria 895
151 Ga0307416_100643609 3300032002 Bacteria 1144
152 Ga0307416_101453045 3300032002 Bacteria 791
153 Ga0307414_10964194 3300032004 Unclassified 784
154 Ga0307414_11117538 3300032004 Bacteria 728
155 Ga0307414_11286451 3300032004 Bacteria 678
156 Ga0307411_10668434 3300032005 Bacteria 901
157 Ga0395905_0554477 3300037471 Unclassified 1050
158 Ga0451789_0918748 3300041443 Unclassified 879
159 Ga0451793_1533984 3300041452 Bacteria 713
160 Ga0451798_0317026 3300041458 Unclassified 609
161 Ga0451800_1391149 3300041459 Unclassified 577
162 Ga0451835_0569739 3300041492 Bacteria 640
163 Ga0451853_1204426 3300041512 Bacteria 2176
164 Ga0451853_3967081 3300041512 Bacteria 973
165 Ga0439449_0057923 3300042007 Unclassified 1430
166 Ga0439462_0024094 3300042015 Unclassified 1597
167 Ga0439446_0211734 3300042156 Bacteria 657
168 Ga0495638_0460928 3300046460 Unclassified 647
169 Ga0495668_0000023 3300046616 Bacteria 363848
170 Ga0495611_0000135 3300046648 Bacteria 51495
171 Ga0501298_006386 3300049521 Bacteria 1927
172 Ga0501047_0068175 3300049581 Bacteria 3427
173 Ga0501047_0426830 3300049581 Bacteria 1157
174 Ga0501202_001169 3300049652 Bacteria 4124
175 Ga0501207_013295 3300049654 Bacteria 1245
176 Ga0501242_003325 3300049674 Bacteria 1735
177 Ga0501259_015517 3300049688 Bacteria 1302
178 Ga0501261_063176 3300049690 Bacteria 634
179 Ga0501241_111424 3300049758 Bacteria 599
180 Ga0501268_088091 3300049765 Bacteria 650
181 Ga0501212_030366 3300049851 Bacteria 869
182 nmdc:mga09592_21146_c1 3300050508 Bacteria 5360
183 nmdc:mga06r32_398674_c2 3300050510 Bacteria 956
184 nmdc:mga08y16_664659_c1 3300050511 Bacteria 1045
185 nmdc:mga0rr50_413838_c1 3300050513 Unclassified 1140
186 Ga0500581_211117 3300053089 Unclassified 852
187 Ga0500646_0025563 3300053090 Unclassified 1596
188 Ga0500583_0292496 3300053092 Bacteria 798
189 Ga0500651_0089553 3300053093 Bacteria 1896
190 Ga0500650_0240552 3300053098 Unclassified 814
191 Ga0500556_0032738 3300053104 Unclassified 1778
192 Ga0500607_316533 3300053121 Unclassified 564
193 Ga0500559_0085221 3300053136 Unclassified 1441
194 Ga0500588_0010526 3300053146 Unclassified 2237
195 Ga0500588_0079128 3300053146 Unclassified 1096
196 Ga0500604_0076616 3300053151 Bacteria 1075
197 Ga0500622_0027542 3300053156 Bacteria 2996
198 Ga0500633_0000132 3300053160 Bacteria 10060
199 Ga0500634_0061325 3300053161 Bacteria 1995
200 Ga0500636_0196894 3300053177 Unclassified 1069
201 Ga0500611_000098 3300053727 Bacteria 23666
202 Ga0500645_043302 3300053730 Bacteria 1326
203 Ga0500587_047702 3300053739 Bacteria 629
204 2738726697 2738541278 Bacteria 9755573
205 2929159131 2929154850 Bacteria 6753285
206 2929243152 2929239360 Bacteria 7745570
207 Ga0207654_10155331
208 MRS1b_contig_4113148
209 rootH2_10022652
210 rootH2_10098791
211 Ga0055535_1001043
212 Ga0055531_10000063
213 Ga0065704_10107730
214 Ga0065712_10013783
215 Ga0070658_10236430
216 Ga0070670_101137207
217 Ga0070670_101834127
218 Ga0070670_101968789
219 Ga0070677_10068542
220 Ga0070677_10800022
221 Ga0070689_101606578
222 Ga0070661_100220271
223 Ga0070668_100437655
224 Ga0070669_100174873
225 Ga0070669_101049287
226 Ga0070669_101052716
227 Ga0070675_100042595
228 Ga0070675_100094506
229 Ga0070671_100129287
230 Ga0070674_100048242
231 Ga0070659_100443356
232 Ga0070667_100350633
233 Ga0070711_100402482
234 Ga0070678_101998860
235 Ga0070662_100731792
236 Ga0070681_10101248
237 Ga0070681_11020606
238 Ga0068867_100869609
239 Ga0070685_10380457
240 Ga0070679_100018575
241 Ga0068853_100018132
242 Ga0068853_100042566
243 Ga0070672_100129272
244 Ga0070665_100009493
245 Ga0070704_101267001
246 Ga0068855_100011432
247 Ga0068855_101405223
248 Ga0070664_100003530
249 Ga0068857_100000786
250 Ga0068857_102117636
251 Ga0068854_100004997
252 Ga0068856_100090257
253 Ga0068852_100024479
254 Ga0068852_100256455
255 Ga0068852_100271253
256 Ga0068866_10789155
257 Ga0068861_101176895
258 Ga0068851_10010658
259 Ga0068870_10175794
260 Ga0068870_11022229
261 Ga0068862_101396854
262 Ga0068862_102493197
263 Ga0097621_100464335
264 Ga0097621_101543775
265 Ga0075428_100005930
266 Ga0075429_100014192
267 Ga0105240_10007620
268 Ga0105240_10079581
269 Ga0105240_10740248
270 Ga0111539_10153043
271 Ga0105241_10104156
272 Ga0105241_10169918
273 Ga0105242_10101797
274 Ga0105242_10657722
275 Ga0105248_12703008
276 Ga0105237_10007625
277 Ga0105237_10030800
278 Ga0105237_10149906
279 Ga0105237_10421956
280 Ga0105238_10001145
281 Ga0105238_10627468
282 Ga0105249_13332320
283 Ga0105239_10186740
284 Ga0157373_10042020
285 Ga0157373_10166302
286 Ga0157371_10028413
287 Ga0157371_10033035
288 Ga0157371_10325789
289 Ga0157371_10344230
290 Ga0157369_10061206
291 Ga0157369_10190351
292 Ga0157374_10093133
293 Ga0157374_10639529
294 Ga0163162_11927384
295 Ga0157372_10000231
296 Ga0157372_10101925
297 Ga0157372_10427016
298 Ga0157372_11287447
299 Ga0157372_12694307
300 Ga0157375_10319752
301 Ga0163163_10854030
302 Ga0163163_13051145
303 Ga0157380_10272582
304 Ga0157377_10021039
305 Ga0157377_10593308
306 Ga0157376_11645251
307 Ga0209258_100252
308 Ga0209258_109426
309 Ga0209148_1000217
310 Ga0209758_1050966
311 Ga0209257_1000008
312 Ga0207656_10026830
313 Ga0207682_10245984
314 Ga0207680_10443578
315 Ga0207647_10008370
316 Ga0207647_10011395
317 Ga0207643_10192943
318 Ga0207654_10065809
319 Ga0207707_10148680
320 Ga0207695_10041120
321 Ga0207695_10044591
322 Ga0207695_10173173
323 Ga0207671_10000468
324 Ga0207671_10018649
325 Ga0207694_10004084
326 Ga0207694_10443140
327 Ga0207694_10736184
328 Ga0207650_11638909
329 Ga0207659_10057317
330 Ga0207659_10061915
331 Ga0207686_11352781
332 Ga0207691_10024905
333 Ga0207661_10113605
334 Ga0207661_10434499
335 Ga0207667_10000100
336 Ga0207667_11082113
337 Ga0207640_10003587
338 Ga0207639_10046889
339 Ga0207639_10053099
340 Ga0207702_10926703
341 Ga0207648_10129609
342 Ga0207648_11527725
343 Ga0207674_10002387
344 Ga0207674_11871696
345 Ga0207683_11002211
346 Ga0207698_10001588
347 Ga0207698_10244502
348 Ga0207698_10316741
349 Ga0268266_10004680
350 Ga0268265_10284529
351 Ga0307509_10461403
352 Ga0307405_10170523
353 Ga0307413_11321901
354 Ga0307413_11883096
355 Ga0307406_11011458
356 Ga0307409_100907344
357 Ga0307416_100643609
358 Ga0307416_101453045
359 Ga0307414_10964194
360 Ga0307414_11117538
361 Ga0307414_11286451
362 Ga0307411_10668434
363 Ga0395905_0554477
364 Ga0451789_0918748
365 Ga0451793_1533984
366 Ga0451798_0317026
367 Ga0451800_1391149
368 Ga0451835_0569739
369 Ga0451853_1204426
370 Ga0451853_3967081
371 Ga0439449_0057923
372 Ga0439462_0024094
373 Ga0439446_0211734
374 Ga0495638_0460928
375 Ga0495668_0000023
376 Ga0495611_0000135
377 Ga0501298_006386
378 Ga0501047_0068175
379 Ga0501047_0426830
380 Ga0501202_001169
381 Ga0501207_013295
382 Ga0501242_003325
383 Ga0501259_015517
384 Ga0501261_063176
385 Ga0501241_111424
386 Ga0501268_088091
387 Ga0501212_030366
388 nmdc:mga09592_21146_c1
389 nmdc:mga06r32_398674_c2
390 nmdc:mga08y16_664659_c1
391 nmdc:mga0rr50_413838_c1
392 Ga0500581_211117
393 Ga0500646_0025563
394 Ga0500583_0292496
395 Ga0500651_0089553
396 Ga0500650_0240552
397 Ga0500556_0032738
398 Ga0500607_316533
399 Ga0500559_0085221
400 Ga0500588_0010526
401 Ga0500588_0079128
402 Ga0500604_0076616
403 Ga0500622_0027542
404 Ga0500633_0000132
405 Ga0500634_0061325
406 Ga0500636_0196894
407 Ga0500611_000098
408 Ga0500645_043302
409 Ga0500587_047702
410 2738726697
411 2929159131
412 2929243152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

29

110

0.98

Map