F315128

General Info

Members Datasets Scaffolds Average Seq Length
206 135 412 316

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10292514|Ga0157372_102925141
Length 363
Sequence MRPALFSRREADFHAGKDRISMPDTSSYSNGHQKPVLRHVLEFEKPLAKLESQIHELEALQAQKQVDYSKELRHLRSNYTSLVRKTYENLSAWETVQVARHPQRPLFRDYVDLICREFRELHGDRYFGDDRAIKCGLARMAGHKVMLIGTHKGRDTKEKIECYFGLAHPEGYRKALRAMKLAEKYGLPVVCLVDTAGAYPGIGAEERGQAESIARNLMEMSRLKTPIITVITGEGGSGGALGLAVADRVAMLEFAWYSVISPEGCSGILWKGNEHAATAAEALKLTSKHLMKLGVIDSVVQEPLGGAHRDPHTAAHNLEQYLAKTLRDLKRVKLENLLERRYEKFRQLGEYVETSRKATRAAS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
134 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
135 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.49
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 1.94
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10292514 3300013307 Bacteria 1894
2 Ga0006562J51391_1038899 3300003578 Bacteria 6560
3 Ga0070683_100291612 3300005329 Bacteria 1552
4 Ga0070670_100101601 3300005331 Bacteria 2476
5 Ga0070689_100090204 3300005340 Bacteria 2415
6 Ga0070661_100189721 3300005344 Bacteria 1567
7 Ga0070714_100014760 3300005435 Bacteria 6277
8 Ga0070714_100069550 3300005435 Bacteria 3041
9 Ga0070708_100007291 3300005445 Bacteria 8849
10 Ga0070708_100075200 3300005445 Bacteria 3048
11 Ga0070706_100033488 3300005467 Bacteria 4742
12 Ga0070707_100002473 3300005468 Bacteria 17611
13 Ga0070699_100001356 3300005518 Bacteria 22549
14 Ga0070699_100044437 3300005518 Bacteria 3846
15 Ga0070672_100082345 3300005543 Bacteria 2581
16 Ga0070665_100002191 3300005548 Bacteria 21789
17 Ga0070665_100308618 3300005548 Bacteria 1585
18 Ga0068856_100009522 3300005614 Bacteria 9438
19 Ga0068858_100145435 3300005842 Bacteria 2226
20 Ga0068860_100116266 3300005843 Bacteria 2559
21 Ga0081538_10023509 3300005981 Bacteria 4427
22 Ga0081540_1010488 3300005983 Bacteria 6265
23 Ga0075370_10009205 3300006353 Bacteria 5116
24 Ga0075428_100041307 3300006844 Bacteria 5073
25 Ga0075428_100070141 3300006844 Bacteria 3831
26 Ga0075431_100000149 3300006847 Bacteria 47617
27 Ga0075433_10135532 3300006852 Bacteria 2189
28 Ga0075435_100029776 3300007076 Bacteria 4287
29 Ga0075435_100213130 3300007076 Bacteria 1639
30 Ga0099794_10000142 3300007265 Bacteria 26665
31 Ga0111539_10016653 3300009094 Bacteria 9111
32 Ga0114129_10029819 3300009147 Bacteria 7725
33 Ga0105241_10173148 3300009174 Bacteria 1784
34 Ga0105249_10313387 3300009553 Bacteria 1578
35 Ga0105239_10027119 3300010375 Bacteria 6306
36 Ga0105239_10047921 3300010375 Bacteria 4683
37 Ga0157369_10103988 3300013105 Bacteria 3025
38 Ga0157369_10229539 3300013105 Bacteria 1941
39 Ga0157369_10257012 3300013105 Bacteria 1822
40 Ga0157374_10219664 3300013296 Bacteria 1865
41 Ga0157378_10189916 3300013297 Bacteria 1937
42 Ga0157372_10065507 3300013307 Bacteria 4079
43 Ga0157372_10086125 3300013307 Bacteria 3564
44 Ga0163161_10107625 3300017792 Bacteria 2081
45 Ga0207684_10041406 3300025910 Bacteria 3906
46 Ga0207695_10000190 3300025913 Bacteria 176747
47 Ga0207649_10010811 3300025920 Bacteria 5019
48 Ga0207649_10139002 3300025920 Bacteria 1659
49 Ga0207687_10091271 3300025927 Bacteria 2221
50 Ga0207700_10101454 3300025928 Bacteria 2296
51 Ga0207664_10007300 3300025929 Bacteria 7663
52 Ga0207664_10267604 3300025929 Bacteria 1496
53 Ga0207670_10064877 3300025936 Bacteria 2505
54 Ga0207691_10026038 3300025940 Bacteria 5490
55 Ga0207667_10315036 3300025949 Bacteria 1598
56 Ga0207702_10001298 3300026078 Bacteria 25025
57 Ga0207648_10135179 3300026089 Bacteria 2172
58 Ga0207674_10002229 3300026116 Bacteria 24542
59 Ga0207674_10085391 3300026116 Bacteria 3151
60 Ga0209588_1000172 3300027671 Bacteria 18186
61 Ga0207428_10009697 3300027907 Bacteria 8627
62 Ga0207428_10202301 3300027907 Bacteria 1494
63 Ga0268266_10000808 3300028379 Bacteria 41511
64 Ga0268266_10141279 3300028379 Bacteria 2161
65 Ga0268264_10049453 3300028381 Unclassified 3498
66 Ga0268264_10150351 3300028381 Bacteria 2087
67 Ga0265337_1000815 3300028556 Bacteria 16406
68 Ga0265337_1027242 3300028556 Bacteria 1724
69 Ga0265319_1000139 3300028563 Bacteria 54503
70 Ga0265319_1003746 3300028563 Bacteria 7800
71 Ga0265334_10001814 3300028573 Bacteria 10179
72 Ga0265318_10018431 3300028577 Bacteria 2848
73 Ga0265318_10057706 3300028577 Bacteria 1450
74 Ga0265323_10000203 3300028653 Bacteria 35735
75 Ga0265322_10000227 3300028654 Bacteria 24741
76 Ga0265322_10030502 3300028654 Bacteria 1540
77 Ga0265336_10000250 3300028666 Bacteria 38151
78 Ga0265338_10000257 3300028800 Bacteria 96951
79 Ga0265338_10003678 3300028800 Bacteria 21371
80 Ga0265338_10004070 3300028800 Bacteria 20039
81 Ga0265338_10006288 3300028800 Bacteria 15181
82 Ga0265338_10032764 3300028800 Bacteria 5057
83 Ga0265332_10000712 3300031238 Bacteria 21066
84 Ga0265328_10002217 3300031239 Bacteria 8757
85 Ga0265320_10000464 3300031240 Bacteria 31747
86 Ga0265325_10013746 3300031241 Bacteria 4597
87 Ga0265329_10002796 3300031242 Bacteria 7795
88 Ga0265339_10000867 3300031249 Bacteria 23253
89 Ga0265339_10016232 3300031249 Bacteria 4445
90 Ga0265339_10058801 3300031249 Bacteria 2075
91 Ga0265331_10007493 3300031250 Bacteria 6310
92 Ga0265316_10140717 3300031344 Bacteria 1813
93 Ga0265314_10007402 3300031711 Bacteria 9518
94 Ga0265342_10003543 3300031712 Bacteria 12776
95 Ga0316576_10030800 3300031727 Bacteria 3802
96 Ga0373937_0060662 3300036401 Bacteria 3475
97 Ga0395900_0259366 3300037418 Bacteria 1737
98 Ga0451577_0083486 3300042876 Bacteria 2850
99 Ga0453683_0000492 3300044673 Bacteria 45269
100 Ga0453683_0006911 3300044673 Bacteria 7738
101 Ga0453683_0047960 3300044673 Bacteria 2679
102 Ga0453683_0284242 3300044673 Bacteria 1057
103 Ga0453684_0069452 3300044712 Bacteria 4468
104 Ga0466960_0029762 3300044901 Bacteria 2509
105 Ga0451576_0101023 3300045051 Bacteria 2999
106 Ga0451576_0186219 3300045051 Bacteria 2168
107 Ga0451576_0517009 3300045051 Bacteria 1254
108 Ga0466967_0002207 3300045976 Bacteria 11970
109 Ga0495592_0155553 3300046454 Bacteria 1578
110 Ga0495590_0054201 3300046457 Bacteria 1401
111 Ga0495662_0093062 3300046476 Bacteria 1471
112 Ga0495664_0130889 3300046477 Bacteria 1519
113 Ga0495608_0042987 3300046511 Bacteria 3021
114 Ga0495608_0260381 3300046511 Bacteria 1080
115 Ga0495630_0008992 3300046517 Bacteria 7174
116 Ga0495665_0137771 3300046531 Bacteria 1276
117 Ga0495667_0036079 3300046559 Bacteria 3302
118 Ga0495634_0045313 3300046642 Bacteria 2974
119 Ga0495635_0121286 3300046663 Bacteria 1783
120 Ga0495647_0116200 3300046681 Bacteria 1121
121 Ga0495624_0019022 3300046690 Bacteria 4588
122 Ga0495670_0062986 3300046691 Bacteria 1867
123 Ga0495649_0000418 3300046694 Bacteria 36933
124 Ga0495636_0000429 3300047318 Bacteria 15575
125 Ga0495674_0000839 3300047319 Bacteria 29332
126 Ga0495684_0036699 3300047471 Bacteria 3757
127 Ga0495602_0231147 3300048088 Bacteria 1389
128 Ga0496104_0220698 3300048907 Bacteria 1808
129 Ga0496111_0269582 3300048914 Unclassified 1263
130 Ga0496117_0015434 3300048920 Bacteria 6513
131 Ga0496117_0031658 3300048920 Bacteria 4034
132 Ga0496118_0033452 3300048921 Bacteria 4217
133 Ga0496122_0025846 3300048925 Bacteria 5084
134 Ga0496123_0040414 3300048926 Bacteria 3248
135 Ga0496125_0000398 3300048928 Bacteria 81112
136 Ga0496126_0046041 3300048929 Bacteria 4005
137 Ga0501032_0049806 3300049569 Bacteria 2826
138 Ga0501034_0000695 3300049571 Bacteria 51148
139 Ga0501034_0001557 3300049571 Bacteria 30023
140 Ga0501036_0005660 3300049572 Bacteria 10138
141 Ga0501036_0075352 3300049572 Bacteria 2854
142 Ga0501036_0137185 3300049572 Bacteria 2065
143 Ga0501038_0014720 3300049574 Bacteria 7127
144 Ga0501038_0054693 3300049574 Bacteria 3432
145 Ga0501040_0001685 3300049576 Bacteria 14158
146 Ga0501040_0035540 3300049576 Bacteria 3379
147 Ga0501040_0191986 3300049576 Bacteria 1449
148 Ga0501041_0047233 3300049577 Bacteria 2620
149 Ga0501042_0019018 3300049578 Bacteria 4766
150 Ga0501042_0054955 3300049578 Bacteria 2840
151 Ga0501043_0027249 3300049579 Bacteria 4487
152 Ga0501046_0055137 3300049580 Bacteria 3125
153 Ga0501046_0144650 3300049580 Bacteria 1796
154 Ga0501048_0036938 3300049582 Bacteria 3509
155 Ga0501048_0045892 3300049582 Bacteria 3119
156 Ga0501048_0211952 3300049582 Bacteria 1374
157 Ga0501068_0029528 3300049584 Bacteria 3247
158 Ga0501070_0175783 3300049586 Bacteria 1763
159 Ga0501070_0303270 3300049586 Bacteria 1301
160 Ga0501071_0054668 3300049587 Bacteria 2880
161 Ga0501072_0022219 3300049588 Bacteria 4922
162 Ga0501072_0111420 3300049588 Bacteria 2178
163 Ga0501074_0022498 3300049590 Bacteria 4579
164 Ga0501074_0267665 3300049590 Bacteria 1215
165 Ga0501075_0026526 3300049591 Bacteria 4267
166 Ga0501075_0043682 3300049591 Bacteria 3361
167 Ga0501075_0065857 3300049591 Bacteria 2734
168 Ga0501075_0085189 3300049591 Bacteria 2394
169 Ga0501075_0088553 3300049591 Bacteria 2347
170 Ga0501075_0125972 3300049591 Bacteria 1950
171 Ga0501076_0039077 3300049592 Bacteria 3725
172 Ga0501076_0054693 3300049592 Bacteria 3163
173 Ga0501076_0290190 3300049592 Bacteria 1340
174 Ga0501077_0005711 3300049593 Bacteria 7574
175 Ga0501077_0015217 3300049593 Bacteria 4839
176 Ga0501077_0024492 3300049593 Bacteria 3833
177 Ga0501079_0005595 3300049741 Bacteria 9375
178 Ga0501079_0078712 3300049741 Bacteria 2550
179 Ga0501080_0119918 3300049742 Bacteria 2438
180 Ga0501080_0401550 3300049742 Bacteria 1233
181 Ga0501081_0001323 3300049743 Bacteria 15125
182 Ga0501081_0003816 3300049743 Bacteria 9651
183 Ga0501081_0027118 3300049743 Bacteria 3866
184 Ga0501081_0033706 3300049743 Bacteria 3481
185 Ga0501081_0181373 3300049743 Bacteria 1523
186 Ga0501081_0252749 3300049743 Bacteria 1287
187 Ga0501035_0129864 3300049822 Bacteria 2197
188 Ga0501035_0432642 3300049822 Bacteria 1091
189 Ga0501045_0015922 3300049824 Bacteria 5334
190 Ga0501045_0290546 3300049824 Bacteria 1216
191 nmdc:mga05p37_92316_c1 3300050507 Bacteria 3730
192 nmdc:mga08y16_7647_c1 3300050511 Bacteria 11308
193 nmdc:mga0a205_41333_c1 3300050515 Bacteria 4439
194 Ga0500651_0028091 3300053093 Bacteria 3538
195 Ga0501084_0037786 3300054114 Bacteria 4035
196 Ga0501084_0156818 3300054114 Bacteria 1920
197 Ga0501082_0036026 3300060353 Bacteria 4263
198 Ga0501082_0105701 3300060353 Bacteria 2435
199 Ga0530510_0000187 3300061734 Bacteria 37901
200 Ga0530510_0004582 3300061734 Bacteria 9564
201 Ga0530510_0008391 3300061734 Bacteria 7203
202 Ga0530510_0064770 3300061734 Bacteria 2647
203 Ga0530510_0105196 3300061734 Bacteria 2065
204 2600198396 2599185353 Bacteria 2219443
205 2600402094 2600254943 Bacteria 2613887
206 2687238788 2684623219 Bacteria 8442773
207 Ga0157372_10292514
208 Ga0006562J51391_1038899
209 Ga0070683_100291612
210 Ga0070670_100101601
211 Ga0070689_100090204
212 Ga0070661_100189721
213 Ga0070714_100014760
214 Ga0070714_100069550
215 Ga0070708_100007291
216 Ga0070708_100075200
217 Ga0070706_100033488
218 Ga0070707_100002473
219 Ga0070699_100001356
220 Ga0070699_100044437
221 Ga0070672_100082345
222 Ga0070665_100002191
223 Ga0070665_100308618
224 Ga0068856_100009522
225 Ga0068858_100145435
226 Ga0068860_100116266
227 Ga0081538_10023509
228 Ga0081540_1010488
229 Ga0075370_10009205
230 Ga0075428_100041307
231 Ga0075428_100070141
232 Ga0075431_100000149
233 Ga0075433_10135532
234 Ga0075435_100029776
235 Ga0075435_100213130
236 Ga0099794_10000142
237 Ga0111539_10016653
238 Ga0114129_10029819
239 Ga0105241_10173148
240 Ga0105249_10313387
241 Ga0105239_10027119
242 Ga0105239_10047921
243 Ga0157369_10103988
244 Ga0157369_10229539
245 Ga0157369_10257012
246 Ga0157374_10219664
247 Ga0157378_10189916
248 Ga0157372_10065507
249 Ga0157372_10086125
250 Ga0163161_10107625
251 Ga0207684_10041406
252 Ga0207695_10000190
253 Ga0207649_10010811
254 Ga0207649_10139002
255 Ga0207687_10091271
256 Ga0207700_10101454
257 Ga0207664_10007300
258 Ga0207664_10267604
259 Ga0207670_10064877
260 Ga0207691_10026038
261 Ga0207667_10315036
262 Ga0207702_10001298
263 Ga0207648_10135179
264 Ga0207674_10002229
265 Ga0207674_10085391
266 Ga0209588_1000172
267 Ga0207428_10009697
268 Ga0207428_10202301
269 Ga0268266_10000808
270 Ga0268266_10141279
271 Ga0268264_10049453
272 Ga0268264_10150351
273 Ga0265337_1000815
274 Ga0265337_1027242
275 Ga0265319_1000139
276 Ga0265319_1003746
277 Ga0265334_10001814
278 Ga0265318_10018431
279 Ga0265318_10057706
280 Ga0265323_10000203
281 Ga0265322_10000227
282 Ga0265322_10030502
283 Ga0265336_10000250
284 Ga0265338_10000257
285 Ga0265338_10003678
286 Ga0265338_10004070
287 Ga0265338_10006288
288 Ga0265338_10032764
289 Ga0265332_10000712
290 Ga0265328_10002217
291 Ga0265320_10000464
292 Ga0265325_10013746
293 Ga0265329_10002796
294 Ga0265339_10000867
295 Ga0265339_10016232
296 Ga0265339_10058801
297 Ga0265331_10007493
298 Ga0265316_10140717
299 Ga0265314_10007402
300 Ga0265342_10003543
301 Ga0316576_10030800
302 Ga0373937_0060662
303 Ga0395900_0259366
304 Ga0451577_0083486
305 Ga0453683_0000492
306 Ga0453683_0006911
307 Ga0453683_0047960
308 Ga0453683_0284242
309 Ga0453684_0069452
310 Ga0466960_0029762
311 Ga0451576_0101023
312 Ga0451576_0186219
313 Ga0451576_0517009
314 Ga0466967_0002207
315 Ga0495592_0155553
316 Ga0495590_0054201
317 Ga0495662_0093062
318 Ga0495664_0130889
319 Ga0495608_0042987
320 Ga0495608_0260381
321 Ga0495630_0008992
322 Ga0495665_0137771
323 Ga0495667_0036079
324 Ga0495634_0045313
325 Ga0495635_0121286
326 Ga0495647_0116200
327 Ga0495624_0019022
328 Ga0495670_0062986
329 Ga0495649_0000418
330 Ga0495636_0000429
331 Ga0495674_0000839
332 Ga0495684_0036699
333 Ga0495602_0231147
334 Ga0496104_0220698
335 Ga0496111_0269582
336 Ga0496117_0015434
337 Ga0496117_0031658
338 Ga0496118_0033452
339 Ga0496122_0025846
340 Ga0496123_0040414
341 Ga0496125_0000398
342 Ga0496126_0046041
343 Ga0501032_0049806
344 Ga0501034_0000695
345 Ga0501034_0001557
346 Ga0501036_0005660
347 Ga0501036_0075352
348 Ga0501036_0137185
349 Ga0501038_0014720
350 Ga0501038_0054693
351 Ga0501040_0001685
352 Ga0501040_0035540
353 Ga0501040_0191986
354 Ga0501041_0047233
355 Ga0501042_0019018
356 Ga0501042_0054955
357 Ga0501043_0027249
358 Ga0501046_0055137
359 Ga0501046_0144650
360 Ga0501048_0036938
361 Ga0501048_0045892
362 Ga0501048_0211952
363 Ga0501068_0029528
364 Ga0501070_0175783
365 Ga0501070_0303270
366 Ga0501071_0054668
367 Ga0501072_0022219
368 Ga0501072_0111420
369 Ga0501074_0022498
370 Ga0501074_0267665
371 Ga0501075_0026526
372 Ga0501075_0043682
373 Ga0501075_0065857
374 Ga0501075_0085189
375 Ga0501075_0088553
376 Ga0501075_0125972
377 Ga0501076_0039077
378 Ga0501076_0054693
379 Ga0501076_0290190
380 Ga0501077_0005711
381 Ga0501077_0015217
382 Ga0501077_0024492
383 Ga0501079_0005595
384 Ga0501079_0078712
385 Ga0501080_0119918
386 Ga0501080_0401550
387 Ga0501081_0001323
388 Ga0501081_0003816
389 Ga0501081_0027118
390 Ga0501081_0033706
391 Ga0501081_0181373
392 Ga0501081_0252749
393 Ga0501035_0129864
394 Ga0501035_0432642
395 Ga0501045_0015922
396 Ga0501045_0290546
397 nmdc:mga05p37_92316_c1
398 nmdc:mga08y16_7647_c1
399 nmdc:mga0a205_41333_c1
400 Ga0500651_0028091
401 Ga0501084_0037786
402 Ga0501084_0156818
403 Ga0501082_0036026
404 Ga0501082_0105701
405 Ga0530510_0000187
406 Ga0530510_0004582
407 Ga0530510_0008391
408 Ga0530510_0064770
409 Ga0530510_0105196
410 2600198396
411 2600402094
412 2687238788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

40

349

1

PF01039

Carboxyl_trans

Carboxyl transferase domain

106

330

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9643 21 332
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9582 22 335
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9549 21 332
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9532 23 335
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.952 22 335
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9637 22 335 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9578 22 335 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9357 73 333 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9252 73 333 3.90.226.10
5iniB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8241 78 314 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7U6KKZ1-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.994 72 269 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1H6DBU4-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9918 19 335 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1W9SC91-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9917 64 331 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-X0XXS6-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9916 48 295 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1G3JA39-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9913 69 304 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map