F314812

General Info

Members Datasets Scaffolds Average Seq Length
206 146 412 446

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100053165|Ga0070708_1000531652
Length 486
Sequence MTTAIDHIAIKMGSVRGEQEMSRRISRRSTWYAPIALAIIGIVAACSPTASPSXXXAPNPSQHQPVTITVGVLRPGATQEAVDALNLQISEFQAKYPWITVEPEEYNWTAPTFTAALAAGTLPDVFTIPFTDGKGLIAQHQIVNIDARVRALGYADKFNPNVIVNGQDDKGAISAVPIAAYGMSLTYNRTLFKAAGLDPDKPPTTWDDIRTAAKTIAAKTGVAGYAEMATENTGGWQLTTSTYALGGRMETVGTDGKVTATLNNPETKAALERLKAMRWEDNSMGSTFDYAWGSINQAFAAGQVGMFTGGSDLYTAMVQNNSLKPDDYGVTVIPLEGADAGVLGGGTLAAVNVVTTEAQRDAAVNWIDFYYMQKLLTQEGAIADAQALKANNQPVGVPSLPIFDKATYDASQQWIKDYINVPTAQMTPFTSKIFDQKIVTEPTAHTQELYAALDPVVQAVLTDKNADIDALLTKANQQVQDIIDKG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
72 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
73 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
134 2643221613 Oerskovia sp. Root22 Isolate Unclassified
135 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
136 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
137 2643221721 Oerskovia sp. Root918 Isolate Unclassified
138 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
139 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
140 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
141 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
142 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
143 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
144 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
145 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
146 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 0
Isolates 6.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 10.19
Rhizosphere 79.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100053165 3300005445 Bacteria 3593
2 Ga0070658_10008149 3300005327 Bacteria 8427
3 Ga0070683_100133181 3300005329 Bacteria 2352
4 Ga0070680_100000001 3300005336 Bacteria 276263
5 Ga0070682_100072684 3300005337 Bacteria 2204
6 Ga0068868_100105314 3300005338 Bacteria 2287
7 Ga0070661_100014764 3300005344 Bacteria 5507
8 Ga0070703_10029813 3300005406 Bacteria 1640
9 Ga0070709_10014516 3300005434 Bacteria 4456
10 Ga0070714_100080464 3300005435 Bacteria 2835
11 Ga0070714_100120824 3300005435 Bacteria 2330
12 Ga0070710_10012407 3300005437 Bacteria 4232
13 Ga0070711_100076020 3300005439 Bacteria 2380
14 Ga0070705_100037287 3300005440 Bacteria 2740
15 Ga0070705_100039335 3300005440 Bacteria 2682
16 Ga0070708_100004152 3300005445 Bacteria 11370
17 Ga0070708_100005914 3300005445 Bacteria 9721
18 Ga0070708_100040269 3300005445 Bacteria 4091
19 Ga0070708_100283029 3300005445 Bacteria 1561
20 Ga0070663_100002153 3300005455 Bacteria 11013
21 Ga0070681_10067667 3300005458 Bacteria 3539
22 Ga0070706_100001594 3300005467 Bacteria 23644
23 Ga0070706_100021987 3300005467 Bacteria 5874
24 Ga0070706_100039259 3300005467 Bacteria 4370
25 Ga0070707_100000511 3300005468 Bacteria 38643
26 Ga0070707_100005272 3300005468 Bacteria 12101
27 Ga0070707_100028753 3300005468 Bacteria 5291
28 Ga0070698_100003489 3300005471 Bacteria 17302
29 Ga0070698_100039496 3300005471 Bacteria 4857
30 Ga0070698_100069666 3300005471 Bacteria 3530
31 Ga0070699_100009310 3300005518 Bacteria 8505
32 Ga0070699_100021254 3300005518 Bacteria 5596
33 Ga0070699_100024856 3300005518 Bacteria 5163
34 Ga0070699_100070882 3300005518 Bacteria 3030
35 Ga0070679_100027418 3300005530 Bacteria 5606
36 Ga0070684_100255687 3300005535 Bacteria 1601
37 Ga0070697_100001101 3300005536 Bacteria 20415
38 Ga0070697_100009607 3300005536 Bacteria 7556
39 Ga0070697_100098334 3300005536 Bacteria 2429
40 Ga0070697_100104810 3300005536 Bacteria 2352
41 Ga0070695_100003817 3300005545 Bacteria 8785
42 Ga0070696_100043206 3300005546 Bacteria 3117
43 Ga0081540_1009612 3300005983 Bacteria 6650
44 Ga0070717_10195177 3300006028 Bacteria 1771
45 Ga0070715_10005390 3300006163 Bacteria 4263
46 Ga0070716_100035109 3300006173 Bacteria 2755
47 Ga0075434_100002024 3300006871 Bacteria 17600
48 Ga0075434_100070641 3300006871 Bacteria 3482
49 Ga0075436_100010479 3300006914 Bacteria 6355
50 Ga0075436_100028519 3300006914 Bacteria 3839
51 Ga0075435_100001916 3300007076 Bacteria 13546
52 Ga0075435_100038579 3300007076 Bacteria 3808
53 Ga0099795_10018233 3300007788 Bacteria 2252
54 Ga0099795_10042293 3300007788 Bacteria 1626
55 Ga0111539_10056693 3300009094 Bacteria 4655
56 Ga0114129_10066214 3300009147 Bacteria 5039
57 Ga0114129_10088781 3300009147 Bacteria 4286
58 Ga0105243_10100219 3300009148 Bacteria 2403
59 Ga0105241_10123103 3300009174 Bacteria 2091
60 Ga0105239_10022174 3300010375 Bacteria 6999
61 Ga0105239_10040584 3300010375 Bacteria 5099
62 Ga0157369_10007652 3300013105 Bacteria 12426
63 Ga0157369_10085816 3300013105 Bacteria 3363
64 Ga0157372_10228183 3300013307 Bacteria 2158
65 Ga0157375_10015651 3300013308 Bacteria 6793
66 Ga0163163_10062201 3300014325 Bacteria 3699
67 Ga0163163_10078633 3300014325 Bacteria 3295
68 Ga0157376_10081582 3300014969 Bacteria 2777
69 Ga0207647_10035733 3300025904 Bacteria 3164
70 Ga0207699_10023962 3300025906 Bacteria 3330
71 Ga0207684_10000143 3300025910 Bacteria 127272
72 Ga0207684_10011094 3300025910 Bacteria 7888
73 Ga0207684_10017537 3300025910 Bacteria 6140
74 Ga0207654_10016481 3300025911 Bacteria 3849
75 Ga0207693_10016265 3300025915 Bacteria 5948
76 Ga0207693_10024038 3300025915 Bacteria 4838
77 Ga0207663_10002020 3300025916 Bacteria 9641
78 Ga0207660_10000001 3300025917 Bacteria 1034169
79 Ga0207652_10034772 3300025921 Bacteria 4249
80 Ga0207646_10004068 3300025922 Bacteria 16133
81 Ga0207646_10005637 3300025922 Bacteria 13150
82 Ga0207646_10005691 3300025922 Bacteria 13071
83 Ga0207646_10007900 3300025922 Bacteria 10738
84 Ga0207646_10019598 3300025922 Bacteria 6283
85 Ga0207664_10051906 3300025929 Bacteria 3240
86 Ga0207665_10002043 3300025939 Bacteria 13577
87 Ga0207665_10042790 3300025939 Bacteria 3028
88 Ga0207678_10007817 3300026067 Bacteria 9440
89 Ga0207674_10045155 3300026116 Bacteria 4534
90 Ga0207683_10010196 3300026121 Bacteria 8012
91 Ga0207698_10306481 3300026142 Bacteria 1481
92 Ga0265326_10002528 3300028558 Bacteria 6150
93 Ga0265319_1000692 3300028563 Bacteria 21966
94 Ga0265334_10007693 3300028573 Bacteria 4615
95 Ga0265322_10002736 3300028654 Bacteria 5408
96 Ga0265336_10014293 3300028666 Bacteria 2633
97 Ga0265338_10001442 3300028800 Bacteria 38606
98 Ga0265338_10057858 3300028800 Bacteria 3427
99 Ga0265320_10003885 3300031240 Bacteria 9884
100 Ga0265325_10003870 3300031241 Bacteria 9605
101 Ga0265340_10007322 3300031247 Bacteria 5997
102 Ga0265339_10038602 3300031249 Bacteria 2663
103 Ga0265316_10006915 3300031344 Bacteria 10760
104 Ga0265314_10091438 3300031711 Bacteria 1980
105 Ga0307510_10179988 3300033180 Bacteria 1678
106 Ga0373952_0006842 3300035092 Bacteria 2122
107 Ga0373932_0002953 3300035112 Bacteria 4187
108 Ga0373942_0029376 3300035207 Bacteria 1442
109 Ga0373931_0036458 3300035691 Bacteria 2563
110 Ga0466972_0007919 3300044658 Bacteria 5328
111 Ga0466961_0094195 3300044693 Bacteria 1890
112 Ga0466963_0038114 3300044694 Bacteria 3142
113 Ga0466970_0107308 3300044765 Bacteria 1524
114 Ga0466967_0014023 3300045976 Bacteria 6223
115 Ga0495629_0052202 3300046459 Bacteria 2861
116 Ga0495662_0067944 3300046476 Bacteria 1725
117 Ga0495664_0022737 3300046477 Bacteria 3637
118 Ga0495630_0014998 3300046517 Bacteria 5654
119 Ga0495586_0022029 3300046535 Bacteria 3401
120 Ga0495634_0047379 3300046642 Bacteria 2897
121 Ga0495588_0096564 3300046674 Bacteria 1550
122 Ga0495604_0008914 3300047317 Bacteria 7929
123 Ga0495674_0011221 3300047319 Bacteria 8458
124 Ga0495684_0020305 3300047471 Bacteria 5119
125 Ga0496102_0000453 3300048905 Bacteria 46525
126 Ga0496102_0005174 3300048905 Bacteria 11068
127 Ga0496102_0047594 3300048905 Bacteria 3898
128 Ga0496102_0143612 3300048905 Bacteria 2239
129 Ga0496103_0009164 3300048906 Bacteria 5860
130 Ga0496103_0035025 3300048906 Bacteria 3072
131 Ga0496103_0038547 3300048906 Bacteria 2933
132 Ga0496104_0011758 3300048907 Bacteria 7853
133 Ga0496104_0062260 3300048907 Bacteria 3538
134 Ga0496105_0030635 3300048908 Bacteria 4408
135 Ga0496105_0046735 3300048908 Bacteria 3572
136 Ga0496105_0067010 3300048908 Bacteria 2964
137 Ga0496106_0089025 3300048909 Bacteria 2380
138 Ga0496108_0007023 3300048911 Bacteria 9117
139 Ga0496108_0046711 3300048911 Bacteria 3618
140 Ga0496109_0003271 3300048912 Bacteria 13516
141 Ga0496109_0031830 3300048912 Bacteria 4737
142 Ga0496109_0093467 3300048912 Bacteria 2783
143 Ga0496111_0080796 3300048914 Bacteria 2372
144 Ga0496112_0014371 3300048915 Bacteria 7340
145 Ga0496113_0079227 3300048916 Bacteria 2514
146 Ga0496117_0001146 3300048920 Bacteria 39905
147 Ga0496118_0042697 3300048921 Bacteria 3575
148 Ga0496122_0001447 3300048925 Bacteria 38346
149 Ga0496122_0011413 3300048925 Bacteria 8999
150 Ga0496123_0006906 3300048926 Bacteria 10859
151 Ga0496123_0010612 3300048926 Bacteria 8107
152 Ga0496124_0007197 3300048927 Bacteria 11892
153 Ga0496125_0005509 3300048928 Bacteria 14034
154 Ga0496126_0005102 3300048929 Bacteria 15220
155 Ga0501031_0004671 3300049568 Bacteria 8894
156 Ga0501032_0009473 3300049569 Bacteria 7061
157 Ga0501032_0011477 3300049569 Bacteria 6364
158 Ga0501034_0011433 3300049571 Bacteria 9197
159 Ga0501034_0019936 3300049571 Bacteria 6848
160 Ga0501036_0023465 3300049572 Bacteria 5197
161 Ga0501038_0000122 3300049574 Bacteria 65832
162 Ga0501038_0006544 3300049574 Bacteria 10775
163 Ga0501043_0020103 3300049579 Bacteria 5241
164 Ga0501046_0003953 3300049580 Bacteria 13538
165 Ga0501046_0016759 3300049580 Bacteria 6126
166 Ga0501047_0004480 3300049581 Bacteria 13142
167 Ga0501047_0012785 3300049581 Bacteria 7952
168 Ga0501048_0059431 3300049582 Bacteria 2709
169 Ga0501067_0073116 3300049583 Bacteria 1900
170 Ga0501074_0122138 3300049590 Bacteria 1863
171 Ga0501080_0277284 3300049742 Bacteria 1525
172 Ga0501083_0007784 3300049744 Bacteria 7590
173 Ga0501083_0013330 3300049744 Bacteria 5748
174 Ga0501035_0004604 3300049822 Bacteria 13079
175 Ga0501035_0100995 3300049822 Bacteria 2532
176 Ga0501044_0026301 3300049823 Bacteria 6162
177 Ga0501044_0028469 3300049823 Bacteria 5897
178 nmdc:mga05p37_62124_c1 3300050507 Bacteria 4597
179 nmdc:mga05p37_81508_c1 3300050507 Bacteria 3986
180 nmdc:mga06r32_38453_c1 3300050510 Bacteria 4533
181 nmdc:mga08y16_53717_c1 3300050511 Bacteria 4211
182 nmdc:mga0n895_131474_c1 3300050512 Bacteria 2528
183 nmdc:mga0n895_20071_c1 3300050512 Bacteria 6223
184 nmdc:mga0n895_65671_c1 3300050512 Bacteria 3592
185 nmdc:mga0rr50_22615_c1 3300050513 Bacteria 4318
186 nmdc:mga08x19_11442_c1 3300050514 Bacteria 5339
187 nmdc:mga08x19_37692_c1 3300050514 Bacteria 3069
188 Ga0495595_0076513 3300053084 Bacteria 1589
189 Ga0500628_003339 3300053129 Bacteria 2648
190 Ga0500616_0000010 3300053153 Bacteria 761410
191 Ga0500645_010357 3300053730 Bacteria 3088
192 Ga0501082_0077005 3300060353 Bacteria 2875
193 2644014754 2643221601 Bacteria 7493239
194 2644083702 2643221613 Bacteria 4622396
195 2644503152 2643221690 Bacteria 4654705
196 2644527483 2643221694 Bacteria 4392972
197 2644664114 2643221721 Bacteria 4486924
198 2644667449 2643221722 Bacteria 4247614
199 2857734229 2857733635 Bacteria 3532004
200 2917738277 2917736166 Bacteria 9690793
201 2928093199 2928090899 Bacteria 3158267
202 2928122145 2928121344 Bacteria 3972376
203 2935891492 2935890801 Bacteria 4593001
204 2939659853 2939657138 Bacteria 3740283
205 2984583183 2984580707 Bacteria 3351387
206 8057346423 8057345674 Bacteria 4160394
207 Ga0070708_100053165
208 Ga0070658_10008149
209 Ga0070683_100133181
210 Ga0070680_100000001
211 Ga0070682_100072684
212 Ga0068868_100105314
213 Ga0070661_100014764
214 Ga0070703_10029813
215 Ga0070709_10014516
216 Ga0070714_100080464
217 Ga0070714_100120824
218 Ga0070710_10012407
219 Ga0070711_100076020
220 Ga0070705_100037287
221 Ga0070705_100039335
222 Ga0070708_100004152
223 Ga0070708_100005914
224 Ga0070708_100040269
225 Ga0070708_100283029
226 Ga0070663_100002153
227 Ga0070681_10067667
228 Ga0070706_100001594
229 Ga0070706_100021987
230 Ga0070706_100039259
231 Ga0070707_100000511
232 Ga0070707_100005272
233 Ga0070707_100028753
234 Ga0070698_100003489
235 Ga0070698_100039496
236 Ga0070698_100069666
237 Ga0070699_100009310
238 Ga0070699_100021254
239 Ga0070699_100024856
240 Ga0070699_100070882
241 Ga0070679_100027418
242 Ga0070684_100255687
243 Ga0070697_100001101
244 Ga0070697_100009607
245 Ga0070697_100098334
246 Ga0070697_100104810
247 Ga0070695_100003817
248 Ga0070696_100043206
249 Ga0081540_1009612
250 Ga0070717_10195177
251 Ga0070715_10005390
252 Ga0070716_100035109
253 Ga0075434_100002024
254 Ga0075434_100070641
255 Ga0075436_100010479
256 Ga0075436_100028519
257 Ga0075435_100001916
258 Ga0075435_100038579
259 Ga0099795_10018233
260 Ga0099795_10042293
261 Ga0111539_10056693
262 Ga0114129_10066214
263 Ga0114129_10088781
264 Ga0105243_10100219
265 Ga0105241_10123103
266 Ga0105239_10022174
267 Ga0105239_10040584
268 Ga0157369_10007652
269 Ga0157369_10085816
270 Ga0157372_10228183
271 Ga0157375_10015651
272 Ga0163163_10062201
273 Ga0163163_10078633
274 Ga0157376_10081582
275 Ga0207647_10035733
276 Ga0207699_10023962
277 Ga0207684_10000143
278 Ga0207684_10011094
279 Ga0207684_10017537
280 Ga0207654_10016481
281 Ga0207693_10016265
282 Ga0207693_10024038
283 Ga0207663_10002020
284 Ga0207660_10000001
285 Ga0207652_10034772
286 Ga0207646_10004068
287 Ga0207646_10005637
288 Ga0207646_10005691
289 Ga0207646_10007900
290 Ga0207646_10019598
291 Ga0207664_10051906
292 Ga0207665_10002043
293 Ga0207665_10042790
294 Ga0207678_10007817
295 Ga0207674_10045155
296 Ga0207683_10010196
297 Ga0207698_10306481
298 Ga0265326_10002528
299 Ga0265319_1000692
300 Ga0265334_10007693
301 Ga0265322_10002736
302 Ga0265336_10014293
303 Ga0265338_10001442
304 Ga0265338_10057858
305 Ga0265320_10003885
306 Ga0265325_10003870
307 Ga0265340_10007322
308 Ga0265339_10038602
309 Ga0265316_10006915
310 Ga0265314_10091438
311 Ga0307510_10179988
312 Ga0373952_0006842
313 Ga0373932_0002953
314 Ga0373942_0029376
315 Ga0373931_0036458
316 Ga0466972_0007919
317 Ga0466961_0094195
318 Ga0466963_0038114
319 Ga0466970_0107308
320 Ga0466967_0014023
321 Ga0495629_0052202
322 Ga0495662_0067944
323 Ga0495664_0022737
324 Ga0495630_0014998
325 Ga0495586_0022029
326 Ga0495634_0047379
327 Ga0495588_0096564
328 Ga0495604_0008914
329 Ga0495674_0011221
330 Ga0495684_0020305
331 Ga0496102_0000453
332 Ga0496102_0005174
333 Ga0496102_0047594
334 Ga0496102_0143612
335 Ga0496103_0009164
336 Ga0496103_0035025
337 Ga0496103_0038547
338 Ga0496104_0011758
339 Ga0496104_0062260
340 Ga0496105_0030635
341 Ga0496105_0046735
342 Ga0496105_0067010
343 Ga0496106_0089025
344 Ga0496108_0007023
345 Ga0496108_0046711
346 Ga0496109_0003271
347 Ga0496109_0031830
348 Ga0496109_0093467
349 Ga0496111_0080796
350 Ga0496112_0014371
351 Ga0496113_0079227
352 Ga0496117_0001146
353 Ga0496118_0042697
354 Ga0496122_0001447
355 Ga0496122_0011413
356 Ga0496123_0006906
357 Ga0496123_0010612
358 Ga0496124_0007197
359 Ga0496125_0005509
360 Ga0496126_0005102
361 Ga0501031_0004671
362 Ga0501032_0009473
363 Ga0501032_0011477
364 Ga0501034_0011433
365 Ga0501034_0019936
366 Ga0501036_0023465
367 Ga0501038_0000122
368 Ga0501038_0006544
369 Ga0501043_0020103
370 Ga0501046_0003953
371 Ga0501046_0016759
372 Ga0501047_0004480
373 Ga0501047_0012785
374 Ga0501048_0059431
375 Ga0501067_0073116
376 Ga0501074_0122138
377 Ga0501080_0277284
378 Ga0501083_0007784
379 Ga0501083_0013330
380 Ga0501035_0004604
381 Ga0501035_0100995
382 Ga0501044_0026301
383 Ga0501044_0028469
384 nmdc:mga05p37_62124_c1
385 nmdc:mga05p37_81508_c1
386 nmdc:mga06r32_38453_c1
387 nmdc:mga08y16_53717_c1
388 nmdc:mga0n895_131474_c1
389 nmdc:mga0n895_20071_c1
390 nmdc:mga0n895_65671_c1
391 nmdc:mga0rr50_22615_c1
392 nmdc:mga08x19_11442_c1
393 nmdc:mga08x19_37692_c1
394 Ga0495595_0076513
395 Ga0500628_003339
396 Ga0500616_0000010
397 Ga0500645_010357
398 Ga0501082_0077005
399 2644014754
400 2644083702
401 2644503152
402 2644527483
403 2644664114
404 2644667449
405 2857734229
406 2917738277
407 2928093199
408 2928122145
409 2935891492
410 2939659853
411 2984583183
412 8057346423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

74

374

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kea-assembly3.cif.gz_C crystal structure of mbp-tagged rev7-ipab complex 0.739 43 439
1peb-assembly1.cif.gz_A ligand-free high-affinity maltose-binding protein 0.739 43 437
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.7381 43 442
7cy6-assembly1.cif.gz_A crystal structure of cmd1 in complex with 5mc-dna 0.738 43 442
7cy5-assembly1.cif.gz_A crystal structure of cmd1 in complex with vitamin c 0.7369 43 442
ID Description Score Start End Superfamily
5ci5B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8218 160 440 3.40.190.10
5ci5B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8106 160 440 3.40.190.10
4aq4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7835 160 442 3.40.190.10
4rjzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7799 161 439 3.40.190.10
3k01A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7747 161 444 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1H8ADX4-F1-model_v4 ABC-type glycerol-3-phosphate transport system, substrate-binding protein 0.9038 12 440 GO:0030313
AF-A0A4R0IQM4-F1-model_v4 Extracellular solute-binding protein 0.9018 9 442 GO:0030313
AF-A0A0Q6DNE3-F1-model_v4 deleted 0.8936 47 444
AF-A0A4R0IQM4-F1-model_v4 Extracellular solute-binding protein 0.8799 9 442 GO:0030313
AF-A0A1C5EJG7-F1-model_v4 DNA-binding transcriptional regulator, LacI/PurR family 0.8783 4 442 GO:0000976
GO:0003700

Map