F314780

General Info

Members Datasets Scaffolds Average Seq Length
206 167 412 247

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100029266|Ga0070714_1000292662
Length 285
Sequence MDPGKCLKSLRDITRGPDPRATDFPGHAADTLVAMADSYRLVLLRHGESAWNAKNLFTGWVDVDLTAQGEEEAIRGGRLLADRGLLPDVLHTSVLRRAIRTAQLALDSIDRHWIPVRRSWRLNERHYGALQGKDKAQTLAEFGEDQFMLWRRSYDTPPPPLAEDAEYSQFADPRYAALPAELRPRTECLEDVVARMLPYWYDAIVPDLLTGRTVLVAAHGNSLRALVKHLDGISDEAIAGLNIPTGIPLLYELDAGLRPLAAGGEYLDPAAAAESIEAVKNQGRK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
69 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
70 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
142 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
143 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
144 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
145 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
146 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
147 2808606448 Streptomyces sp. 193411 Isolate Unclassified
148 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
149 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
150 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
151 2858868258 Micromonospora sp. MH33 Isolate Unclassified
152 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
153 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
154 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
155 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
156 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
157 2902582711 Micromonospora sp. AP08 Isolate Unclassified
158 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
159 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
160 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
161 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
162 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
163 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
164 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
165 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
166 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
167 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.89
Metatranscriptomes 0
Isolates 13.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 0
Rhizoplane 7.28
Rhizosphere 78.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100029266 3300005435 Bacteria 4579
2 JGI24745J21846_1001621 3300002073 Bacteria 2213
3 JGI25406J46586_10017899 3300003203 Bacteria 2919
4 Ga0070683_100411682 3300005329 Bacteria 1289
5 Ga0070683_100703746 3300005329 Bacteria 968
6 Ga0070670_100309519 3300005331 Bacteria 1382
7 Ga0068869_100465158 3300005334 Bacteria 1051
8 Ga0070680_100515159 3300005336 Bacteria 1024
9 Ga0070668_100003946 3300005347 Bacteria 10966
10 Ga0070659_100230276 3300005366 Bacteria 1531
11 Ga0070709_10062280 3300005434 Bacteria 2378
12 Ga0070709_10188359 3300005434 Bacteria 1454
13 Ga0070713_100176158 3300005436 Bacteria 1919
14 Ga0070665_100035018 3300005548 Bacteria 5051
15 Ga0068855_100295869 3300005563 Bacteria 1793
16 Ga0068857_100453059 3300005577 Bacteria 1200
17 Ga0068856_100267089 3300005614 Bacteria 1727
18 Ga0068852_100142395 3300005616 Bacteria 2220
19 Ga0068864_100015493 3300005618 Bacteria 6338
20 Ga0068851_10132417 3300005834 Bacteria 1349
21 Ga0068863_100054026 3300005841 Bacteria 3807
22 Ga0068863_100284817 3300005841 Bacteria 1602
23 Ga0068858_100167884 3300005842 Bacteria 2068
24 Ga0068858_100245724 3300005842 Bacteria 1699
25 Ga0068860_100247379 3300005843 Bacteria 1735
26 Ga0068862_100074005 3300005844 Bacteria 2944
27 Ga0081540_1014505 3300005983 Bacteria 5041
28 Ga0081539_10000094 3300005985 Bacteria 206102
29 Ga0081539_10107249 3300005985 Bacteria 1413
30 Ga0075365_10019537 3300006038 Bacteria 4184
31 Ga0070712_100173045 3300006175 Bacteria 1677
32 Ga0105243_10090050 3300009148 Bacteria 2524
33 Ga0105243_10489772 3300009148 Bacteria 1162
34 Ga0105248_10015154 3300009177 Bacteria 8493
35 Ga0163162_10346434 3300013306 Bacteria 1618
36 Ga0157372_10076806 3300013307 Bacteria 3771
37 Ga0163163_10034246 3300014325 Bacteria 4917
38 Ga0163163_10127845 3300014325 Bacteria 2579
39 Ga0163163_10270984 3300014325 Bacteria 1749
40 Ga0163163_10619275 3300014325 Bacteria 1146
41 Ga0182008_10228048 3300014497 Bacteria 955
42 Ga0157379_10179499 3300014968 Bacteria 1913
43 Ga0163161_10019238 3300017792 Bacteria 4788
44 Ga0207656_10030946 3300025321 Bacteria 2214
45 Ga0207693_10115724 3300025915 Bacteria 2105
46 Ga0207652_10308794 3300025921 Bacteria 1427
47 Ga0207681_10230153 3300025923 Bacteria 1438
48 Ga0207681_10238664 3300025923 Bacteria 1414
49 Ga0207664_10029680 3300025929 Bacteria 4167
50 Ga0207690_10416826 3300025932 Bacteria 1074
51 Ga0207709_10118527 3300025935 Bacteria 1783
52 Ga0207704_10343283 3300025938 Bacteria 1160
53 Ga0207665_10526445 3300025939 Bacteria 916
54 Ga0207711_10119028 3300025941 Bacteria 2356
55 Ga0207689_10116512 3300025942 Bacteria 2196
56 Ga0207679_10627991 3300025945 Bacteria 970
57 Ga0207668_10002337 3300025972 Bacteria 11074
58 Ga0207668_10027395 3300025972 Bacteria 3711
59 Ga0207658_10171594 3300025986 Bacteria 1787
60 Ga0207703_10033317 3300026035 Bacteria 4083
61 Ga0207639_10598575 3300026041 Bacteria 1016
62 Ga0207708_10024908 3300026075 Bacteria 4527
63 Ga0207641_10120228 3300026088 Bacteria 2343
64 Ga0207676_10246620 3300026095 Bacteria 1605
65 Ga0207674_10137091 3300026116 Bacteria 2408
66 Ga0207675_100183923 3300026118 Bacteria 2002
67 Ga0268265_10075887 3300028380 Bacteria 2635
68 Ga0316177_1066660 3300030731 Bacteria 3885
69 Ga0307513_10006591 3300031456 Bacteria 15154
70 Ga0307509_10023854 3300031507 Bacteria 6858
71 Ga0307508_10017784 3300031616 Bacteria 6466
72 Ga0307508_10100587 3300031616 Bacteria 2486
73 Ga0316576_10038718 3300031727 Bacteria 3420
74 Ga0316576_10380977 3300031727 Bacteria 1047
75 Ga0307516_10495117 3300031730 Bacteria 877
76 Ga0307518_10129222 3300031838 Bacteria 1778
77 Ga0307409_100622725 3300031995 Bacteria 1069
78 Ga0307415_100578205 3300032126 Bacteria 996
79 Ga0307507_10000009 3300033179 Bacteria 265992
80 Ga0307507_10037629 3300033179 Bacteria 4922
81 Ga0307510_10167968 3300033180 Bacteria 1778
82 Ga0307510_10189408 3300033180 Bacteria 1607
83 Ga0373950_0010489 3300034818 Bacteria 1498
84 Ga0373938_0005129 3300034957 Bacteria 2216
85 Ga0373942_0004879 3300035207 Bacteria 3110
86 Ga0373962_0000754 3300035242 Bacteria 7368
87 Ga0373935_0002586 3300035692 Bacteria 10397
88 Ga0373935_0203551 3300035692 Bacteria 1369
89 Ga0436364_1115103 3300037853 Bacteria 5592
90 Ga0439439_0076789 3300041406 Bacteria 899
91 Ga0439433_0035586 3300041999 Bacteria 1148
92 Ga0466969_0005377 3300044656 Bacteria 6815
93 Ga0466969_0023522 3300044656 Bacteria 3175
94 Ga0466969_0104225 3300044656 Bacteria 1332
95 Ga0466966_0138258 3300044684 Bacteria 1489
96 Ga0466961_0003745 3300044693 Bacteria 9503
97 Ga0466963_0146564 3300044694 Bacteria 1638
98 Ga0466970_0069322 3300044765 Bacteria 1895
99 Ga0466959_0002194 3300045049 Bacteria 12414
100 Ga0466959_0011071 3300045049 Bacteria 6473
101 Ga0466959_0042963 3300045049 Bacteria 3334
102 Ga0466958_0002735 3300045836 Bacteria 8950
103 Ga0495592_0015779 3300046454 Bacteria 5731
104 Ga0495592_0124620 3300046454 Bacteria 1809
105 Ga0495629_0125855 3300046459 Bacteria 1785
106 Ga0495629_0184576 3300046459 Bacteria 1445
107 Ga0495651_0000144 3300046462 Bacteria 52145
108 Ga0495651_0001709 3300046462 Bacteria 16956
109 Ga0495618_0006010 3300046514 Bacteria 7377
110 Ga0495628_0002433 3300046516 Bacteria 16783
111 Ga0495652_0001024 3300046529 Bacteria 31928
112 Ga0495652_0011043 3300046529 Bacteria 8185
113 Ga0495645_0024917 3300046543 Bacteria 4342
114 Ga0495645_0076592 3300046543 Bacteria 2406
115 Ga0495634_0101055 3300046642 Bacteria 1863
116 Ga0495635_0008605 3300046663 Bacteria 7126
117 Ga0495657_0330995 3300046675 Bacteria 904
118 Ga0495646_0130432 3300046680 Bacteria 1415
119 Ga0495600_0001484 3300046809 Bacteria 13005
120 Ga0495600_0009145 3300046809 Bacteria 6111
121 Ga0495604_0002270 3300047317 Bacteria 15392
122 Ga0496102_0349209 3300048905 Bacteria 1393
123 Ga0496104_0035073 3300048907 Bacteria 4682
124 Ga0496104_0332758 3300048907 Bacteria 1432
125 Ga0496104_0515661 3300048907 Bacteria 1107
126 Ga0496108_0007912 3300048911 Bacteria 8617
127 Ga0496108_0170297 3300048911 Bacteria 1884
128 Ga0496109_0007146 3300048912 Bacteria 9434
129 Ga0496110_0008446 3300048913 Bacteria 8289
130 Ga0496110_0012484 3300048913 Bacteria 6986
131 Ga0496111_0126526 3300048914 Bacteria 1889
132 Ga0496112_0439827 3300048915 Bacteria 1242
133 Ga0496113_0002286 3300048916 Bacteria 11059
134 Ga0496114_0256194 3300048917 Bacteria 1540
135 Ga0496114_0602028 3300048917 Bacteria 969
136 Ga0501031_0211314 3300049568 Bacteria 1264
137 Ga0501034_0010368 3300049571 Bacteria 9711
138 Ga0501037_0037250 3300049573 Bacteria 3585
139 Ga0501037_0096410 3300049573 Bacteria 2138
140 Ga0501040_0059270 3300049576 Bacteria 2630
141 Ga0501041_0046018 3300049577 Bacteria 2654
142 Ga0501041_0102437 3300049577 Bacteria 1773
143 Ga0501042_0011674 3300049578 Bacteria 5935
144 Ga0501042_0151771 3300049578 Bacteria 1671
145 Ga0501043_0060906 3300049579 Bacteria 2963
146 Ga0501046_0533568 3300049580 Bacteria 838
147 Ga0501047_0003343 3300049581 Bacteria 15195
148 Ga0501047_0481584 3300049581 Bacteria 1068
149 Ga0501070_0005304 3300049586 Bacteria 10997
150 Ga0501070_0702579 3300049586 Bacteria 800
151 Ga0501071_0053538 3300049587 Bacteria 2911
152 Ga0501071_0416292 3300049587 Bacteria 1027
153 Ga0501071_0512560 3300049587 Bacteria 920
154 Ga0501072_0028917 3300049588 Bacteria 4327
155 Ga0501073_0026265 3300049589 Bacteria 4172
156 Ga0501074_0338161 3300049590 Bacteria 1069
157 Ga0501075_0431167 3300049591 Bacteria 1005
158 Ga0501076_0055879 3300049592 Bacteria 3131
159 Ga0501079_0124728 3300049741 Bacteria 2003
160 Ga0501080_0000189 3300049742 Bacteria 44995
161 Ga0501083_0253820 3300049744 Bacteria 1144
162 Ga0501035_0553214 3300049822 Bacteria 942
163 Ga0501044_0091956 3300049823 Bacteria 3060
164 Ga0501045_0152789 3300049824 Bacteria 1717
165 nmdc:mga00v17_174553_c1 3300050491 Bacteria 1386
166 nmdc:mga0yw44_132668_c1 3300050492 Bacteria 1614
167 nmdc:mga0qj67_193128_c1 3300050509 Bacteria 1654
168 Ga0495601_0028352 3300053077 Bacteria 3468
169 Ga0495612_0023893 3300053078 Bacteria 2454
170 Ga0495619_0013120 3300053085 Bacteria 5222
171 Ga0500643_000483 3300053087 Bacteria 29043
172 Ga0500644_0122829 3300053088 Bacteria 1014
173 Ga0500573_0095329 3300053140 Bacteria 1677
174 Ga0500577_0181528 3300053142 Bacteria 903
175 Ga0501084_0045724 3300054114 Bacteria 3665
176 Ga0501084_0424463 3300054114 Bacteria 1124
177 Ga0590075_013192 3300059424 Bacteria 2011
178 Ga0466962_0002524 3300061719 Bacteria 8694
179 Ga0530510_0127024 3300061734 Bacteria 1875
180 2644014778 2643221601 Bacteria 7493239
181 2644176213 2643221631 Bacteria 8168043
182 2731905898 2731639228 Bacteria 4187555
183 2753269928 2751185782 Bacteria 11227053
184 2793978346 2791355406 Bacteria 11364898
185 2799185853 2799112218 Bacteria 4315149
186 2809232344 2808606448 Bacteria 8656184
187 2812357954 2811994879 Bacteria 9313447
188 2819742006 2818991472 Bacteria 10089953
189 2852636525 2852635781 Bacteria 8251373
190 2858874481 2858868258 Bacteria 7683772
191 2862706483 2862705112 Bacteria 6563286
192 2868095533 2868088558 Bacteria 7609351
193 2870727720 2870721527 Bacteria 9689237
194 2873155604 2873151551 Bacteria 8625867
195 2887486874 2887478801 Bacteria 8972725
196 2902584674 2902582711 Bacteria 6187705
197 2946067897 2946064051 Bacteria 8957905
198 8001785311 8001781756 Bacteria 9586736
199 8008490295 8008485437 Bacteria 7198341
200 8023627074 8023623736 Bacteria 8593882
201 8025529597 8025524527 Bacteria 7197316
202 8047897956 8047893842 Bacteria 11723082
203 8048360938 8048356638 Bacteria 11044339
204 8048374919 8048369669 Bacteria 11666822
205 8048383303 8048379754 Bacteria 11877923
206 8056062072 8056060235 Bacteria 7259403
207 Ga0070714_100029266
208 JGI24745J21846_1001621
209 JGI25406J46586_10017899
210 Ga0070683_100411682
211 Ga0070683_100703746
212 Ga0070670_100309519
213 Ga0068869_100465158
214 Ga0070680_100515159
215 Ga0070668_100003946
216 Ga0070659_100230276
217 Ga0070709_10062280
218 Ga0070709_10188359
219 Ga0070713_100176158
220 Ga0070665_100035018
221 Ga0068855_100295869
222 Ga0068857_100453059
223 Ga0068856_100267089
224 Ga0068852_100142395
225 Ga0068864_100015493
226 Ga0068851_10132417
227 Ga0068863_100054026
228 Ga0068863_100284817
229 Ga0068858_100167884
230 Ga0068858_100245724
231 Ga0068860_100247379
232 Ga0068862_100074005
233 Ga0081540_1014505
234 Ga0081539_10000094
235 Ga0081539_10107249
236 Ga0075365_10019537
237 Ga0070712_100173045
238 Ga0105243_10090050
239 Ga0105243_10489772
240 Ga0105248_10015154
241 Ga0163162_10346434
242 Ga0157372_10076806
243 Ga0163163_10034246
244 Ga0163163_10127845
245 Ga0163163_10270984
246 Ga0163163_10619275
247 Ga0182008_10228048
248 Ga0157379_10179499
249 Ga0163161_10019238
250 Ga0207656_10030946
251 Ga0207693_10115724
252 Ga0207652_10308794
253 Ga0207681_10230153
254 Ga0207681_10238664
255 Ga0207664_10029680
256 Ga0207690_10416826
257 Ga0207709_10118527
258 Ga0207704_10343283
259 Ga0207665_10526445
260 Ga0207711_10119028
261 Ga0207689_10116512
262 Ga0207679_10627991
263 Ga0207668_10002337
264 Ga0207668_10027395
265 Ga0207658_10171594
266 Ga0207703_10033317
267 Ga0207639_10598575
268 Ga0207708_10024908
269 Ga0207641_10120228
270 Ga0207676_10246620
271 Ga0207674_10137091
272 Ga0207675_100183923
273 Ga0268265_10075887
274 Ga0316177_1066660
275 Ga0307513_10006591
276 Ga0307509_10023854
277 Ga0307508_10017784
278 Ga0307508_10100587
279 Ga0316576_10038718
280 Ga0316576_10380977
281 Ga0307516_10495117
282 Ga0307518_10129222
283 Ga0307409_100622725
284 Ga0307415_100578205
285 Ga0307507_10000009
286 Ga0307507_10037629
287 Ga0307510_10167968
288 Ga0307510_10189408
289 Ga0373950_0010489
290 Ga0373938_0005129
291 Ga0373942_0004879
292 Ga0373962_0000754
293 Ga0373935_0002586
294 Ga0373935_0203551
295 Ga0436364_1115103
296 Ga0439439_0076789
297 Ga0439433_0035586
298 Ga0466969_0005377
299 Ga0466969_0023522
300 Ga0466969_0104225
301 Ga0466966_0138258
302 Ga0466961_0003745
303 Ga0466963_0146564
304 Ga0466970_0069322
305 Ga0466959_0002194
306 Ga0466959_0011071
307 Ga0466959_0042963
308 Ga0466958_0002735
309 Ga0495592_0015779
310 Ga0495592_0124620
311 Ga0495629_0125855
312 Ga0495629_0184576
313 Ga0495651_0000144
314 Ga0495651_0001709
315 Ga0495618_0006010
316 Ga0495628_0002433
317 Ga0495652_0001024
318 Ga0495652_0011043
319 Ga0495645_0024917
320 Ga0495645_0076592
321 Ga0495634_0101055
322 Ga0495635_0008605
323 Ga0495657_0330995
324 Ga0495646_0130432
325 Ga0495600_0001484
326 Ga0495600_0009145
327 Ga0495604_0002270
328 Ga0496102_0349209
329 Ga0496104_0035073
330 Ga0496104_0332758
331 Ga0496104_0515661
332 Ga0496108_0007912
333 Ga0496108_0170297
334 Ga0496109_0007146
335 Ga0496110_0008446
336 Ga0496110_0012484
337 Ga0496111_0126526
338 Ga0496112_0439827
339 Ga0496113_0002286
340 Ga0496114_0256194
341 Ga0496114_0602028
342 Ga0501031_0211314
343 Ga0501034_0010368
344 Ga0501037_0037250
345 Ga0501037_0096410
346 Ga0501040_0059270
347 Ga0501041_0046018
348 Ga0501041_0102437
349 Ga0501042_0011674
350 Ga0501042_0151771
351 Ga0501043_0060906
352 Ga0501046_0533568
353 Ga0501047_0003343
354 Ga0501047_0481584
355 Ga0501070_0005304
356 Ga0501070_0702579
357 Ga0501071_0053538
358 Ga0501071_0416292
359 Ga0501071_0512560
360 Ga0501072_0028917
361 Ga0501073_0026265
362 Ga0501074_0338161
363 Ga0501075_0431167
364 Ga0501076_0055879
365 Ga0501079_0124728
366 Ga0501080_0000189
367 Ga0501083_0253820
368 Ga0501035_0553214
369 Ga0501044_0091956
370 Ga0501045_0152789
371 nmdc:mga00v17_174553_c1
372 nmdc:mga0yw44_132668_c1
373 nmdc:mga0qj67_193128_c1
374 Ga0495601_0028352
375 Ga0495612_0023893
376 Ga0495619_0013120
377 Ga0500643_000483
378 Ga0500644_0122829
379 Ga0500573_0095329
380 Ga0500577_0181528
381 Ga0501084_0045724
382 Ga0501084_0424463
383 Ga0590075_013192
384 Ga0466962_0002524
385 Ga0530510_0127024
386 2644014778
387 2644176213
388 2731905898
389 2753269928
390 2793978346
391 2799185853
392 2809232344
393 2812357954
394 2819742006
395 2852636525
396 2858874481
397 2862706483
398 2868095533
399 2870727720
400 2873155604
401 2887486874
402 2902584674
403 2946067897
404 8001785311
405 8008490295
406 8023627074
407 8025529597
408 8047897956
409 8048360938
410 8048374919
411 8048383303
412 8056062072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

41

172

0.93

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

163

254

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bq4-assembly1.cif.gz_A saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate 0.9728 3 234
3fdz-assembly1.cif.gz_B crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid 0.9652 1 228
5um0-assembly1.cif.gz_D crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae 0.9644 1 228
1rii-assembly1.cif.gz_D crystal structure of phosphoglycerate mutase from m. tuberculosis 0.9629 2 231
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.9629 1 236
ID Description Score Start End Superfamily
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.983 2 240 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9778 4 230 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9683 4 230 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9591 2 240 3.40.50.1240
3pgmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.94 3 232 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7K0WBJ0-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.992 7 138 GO:0006096
GO:0046538
AF-A0A3D3KRY2-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9889 7 125 GO:0006096
GO:0016868
AF-A0A5C4JC22-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.988 1 235 GO:0006096
GO:0046538
AF-A0A838H0P5-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.988 7 138 GO:0006096
GO:0016868
AF-A0A7G1INM8-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9878 1 136 GO:0006096
GO:0046538

Map