F314776

General Info

Members Datasets Scaffolds Average Seq Length
206 137 412 329

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10019136|Ga0070709_100191364
Length 373
Sequence LLQAAVRWAAMKNPISSPKSRVFAVLLISTCSFLLFSSSLCSLSAAQGEPGAKLAARGVRPNTTLSPQSGAISVYAVQEGFVDANGVMIYYKTLGRGEPLMILHGGPGASHDYFLPYLLPLARHNRLVFIDERGSGRSQKLENPKGYTVENMVEDVETVRQALGLGKISLLGHSYGGALAQAYALKYQKNLSHLILGSTWSSSKAMNDVFVKMKENMSPELRDRIEKLEGAGLFGHGKDYEKNRYTADYMVAAWGEGYFPYVYHNRPDPNYDPVAQGNTAWDLYREMWGEHGEFIIDGNLKSVEYTDRLATIKVPTLLVVGEHDECDPSLSRTMQQKIAGSQLAIMPNSGHMTFVDQPDLFVRTVDGFLHGGR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.17
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 18.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10019136 3300005434 Bacteria 3952
2 Ga0065712_10075810 3300005290 Unclassified 3785
3 Ga0065707_10128329 3300005295 Unclassified 1967
4 Ga0070683_100010099 3300005329 Bacteria 8100
5 Ga0070670_100026018 3300005331 Bacteria 5036
6 Ga0070670_100075251 3300005331 Bacteria 2901
7 Ga0070670_100089988 3300005331 Unclassified 2638
8 Ga0070670_100225881 3300005331 Bacteria 1629
9 Ga0070666_10235083 3300005335 Bacteria 1295
10 Ga0070680_100298644 3300005336 Unclassified 1366
11 Ga0068868_100424562 3300005338 Bacteria 1152
12 Ga0070692_10124462 3300005345 Bacteria 1442
13 Ga0070675_100066609 3300005354 Bacteria 2979
14 Ga0070667_100023579 3300005367 Bacteria 5107
15 Ga0070703_10013346 3300005406 Bacteria 2333
16 Ga0070709_10078009 3300005434 Unclassified 2155
17 Ga0070694_100095356 3300005444 Bacteria 2095
18 Ga0070708_100002285 3300005445 Bacteria 14831
19 Ga0070708_100008515 3300005445 Bacteria 8241
20 Ga0070708_100047277 3300005445 Bacteria 3800
21 Ga0070708_100137660 3300005445 Bacteria 2263
22 Ga0070706_100005601 3300005467 Bacteria 11951
23 Ga0070706_100023534 3300005467 Bacteria 5673
24 Ga0070706_100057235 3300005467 Bacteria 3597
25 Ga0070706_100060445 3300005467 Unclassified 3498
26 Ga0070707_100002539 3300005468 Bacteria 17356
27 Ga0070707_100010324 3300005468 Bacteria 8693
28 Ga0070707_100253484 3300005468 Bacteria 1713
29 Ga0070698_100002494 3300005471 Bacteria 20288
30 Ga0070698_100013352 3300005471 Bacteria 8694
31 Ga0070698_100188771 3300005471 Bacteria 1999
32 Ga0070699_100001174 3300005518 Bacteria 24315
33 Ga0070699_100001347 3300005518 Bacteria 22644
34 Ga0070699_100021102 3300005518 Bacteria 5614
35 Ga0070699_100193606 3300005518 Bacteria 1807
36 Ga0070679_100041593 3300005530 Bacteria 4574
37 Ga0070697_100004987 3300005536 Bacteria 10190
38 Ga0070697_100239567 3300005536 Unclassified 1549
39 Ga0068853_100031364 3300005539 Bacteria 4495
40 Ga0070672_100073680 3300005543 Bacteria 2722
41 Ga0070695_100014728 3300005545 Bacteria 4716
42 Ga0070696_100002004 3300005546 Bacteria 13358
43 Ga0070696_100361106 3300005546 Unclassified 1127
44 Ga0070693_100075689 3300005547 Bacteria 1994
45 Ga0070665_100233389 3300005548 Bacteria 1840
46 Ga0068859_100013558 3300005617 Bacteria 8172
47 Ga0068864_100070757 3300005618 Bacteria 3036
48 Ga0068851_10019740 3300005834 Bacteria 3258
49 Ga0068863_100124445 3300005841 Bacteria 2460
50 Ga0068863_100162205 3300005841 Bacteria 2142
51 Ga0070717_10002436 3300006028 Bacteria 13128
52 Ga0070715_10137734 3300006163 Unclassified 1182
53 Ga0097621_100013118 3300006237 Bacteria 6163
54 Ga0068871_100002700 3300006358 Bacteria 12106
55 Ga0068871_100015971 3300006358 Bacteria 5639
56 Ga0075428_100095200 3300006844 Unclassified 3246
57 Ga0075428_100110039 3300006844 Bacteria 3001
58 Ga0075434_100000074 3300006871 Bacteria 52984
59 Ga0075436_100069770 3300006914 Bacteria 2429
60 Ga0097620_100013558 3300006931 Bacteria 8172
61 Ga0075435_100033616 3300007076 Bacteria 4056
62 Ga0105240_10136820 3300009093 Bacteria 2933
63 Ga0105245_10238716 3300009098 Bacteria 1761
64 Ga0105247_10071869 3300009101 Bacteria 2165
65 Ga0105247_10317887 3300009101 Unclassified 1085
66 Ga0105243_10043678 3300009148 Bacteria 3513
67 Ga0105241_10006197 3300009174 Bacteria 8822
68 Ga0105241_10188204 3300009174 Unclassified 1717
69 Ga0105248_10030863 3300009177 Bacteria 5987
70 Ga0105248_10082397 3300009177 Bacteria 3618
71 Ga0105248_10090669 3300009177 Bacteria 3442
72 Ga0105237_10143024 3300009545 Bacteria 2386
73 Ga0105238_10003254 3300009551 Bacteria 16214
74 Ga0105249_10077581 3300009553 Bacteria 3081
75 Ga0105239_10377529 3300010375 Unclassified 1602
76 Ga0157370_10063178 3300013104 Bacteria 3509
77 Ga0157374_10027365 3300013296 Bacteria 5142
78 Ga0157374_10041521 3300013296 Bacteria 4240
79 Ga0157374_10051871 3300013296 Bacteria 3818
80 Ga0157374_10206657 3300013296 Bacteria 1924
81 Ga0157374_10329163 3300013296 Bacteria 1515
82 Ga0157374_10616932 3300013296 Unclassified 1095
83 Ga0157378_10019592 3300013297 Bacteria 5948
84 Ga0157378_10036461 3300013297 Bacteria 4352
85 Ga0163162_10011315 3300013306 Bacteria 8700
86 Ga0163162_10297977 3300013306 Unclassified 1744
87 Ga0163162_10644227 3300013306 Bacteria 1183
88 Ga0157372_10038686 3300013307 Bacteria 5263
89 Ga0157375_10469700 3300013308 Bacteria 1423
90 Ga0163163_10009123 3300014325 Bacteria 8839
91 Ga0163163_10327776 3300014325 Bacteria 1585
92 Ga0157380_10658800 3300014326 Unclassified 1046
93 Ga0157379_10001230 3300014968 Bacteria 20786
94 Ga0157379_10012799 3300014968 Bacteria 7337
95 Ga0157379_10162726 3300014968 Bacteria 2014
96 Ga0157376_10015365 3300014969 Bacteria 5782
97 Ga0157376_10155073 3300014969 Unclassified 2070
98 Ga0157376_10160558 3300014969 Bacteria 2037
99 Ga0157376_10170505 3300014969 Bacteria 1981
100 Ga0157376_10673913 3300014969 Bacteria 1037
101 Ga0182006_1020095 3300015261 Bacteria 2802
102 Ga0163161_10087057 3300017792 Bacteria 2307
103 Ga0207656_10118174 3300025321 Bacteria 1232
104 Ga0207642_10109217 3300025899 Bacteria 1405
105 Ga0207680_10217287 3300025903 Bacteria 1309
106 Ga0207699_10131428 3300025906 Bacteria 1633
107 Ga0207699_10307001 3300025906 Unclassified 1109
108 Ga0207684_10000203 3300025910 Bacteria 91833
109 Ga0207684_10002559 3300025910 Bacteria 18247
110 Ga0207684_10118099 3300025910 Bacteria 2272
111 Ga0207684_10238601 3300025910 Unclassified 1568
112 Ga0207654_10110162 3300025911 Unclassified 1712
113 Ga0207695_10131922 3300025913 Bacteria 2455
114 Ga0207657_10002104 3300025919 Bacteria 21535
115 Ga0207652_10063346 3300025921 Bacteria 3197
116 Ga0207652_10127356 3300025921 Bacteria 2269
117 Ga0207646_10001084 3300025922 Bacteria 34596
118 Ga0207646_10024906 3300025922 Bacteria 5476
119 Ga0207694_10119893 3300025924 Bacteria 2099
120 Ga0207659_10042468 3300025926 Bacteria 3188
121 Ga0207687_10078002 3300025927 Bacteria 2384
122 Ga0207690_10240789 3300025932 Bacteria 1393
123 Ga0207706_10066597 3300025933 Bacteria 3170
124 Ga0207706_10495085 3300025933 Bacteria 1055
125 Ga0207686_10106411 3300025934 Bacteria 1883
126 Ga0207686_10169817 3300025934 Unclassified 1537
127 Ga0207704_10022764 3300025938 Unclassified 3363
128 Ga0207704_10128628 3300025938 Bacteria 1749
129 Ga0207665_10022582 3300025939 Unclassified 4140
130 Ga0207665_10025663 3300025939 Bacteria 3889
131 Ga0207665_10172343 3300025939 Bacteria 1563
132 Ga0207691_10005419 3300025940 Bacteria 12311
133 Ga0207711_10092060 3300025941 Bacteria 2668
134 Ga0207667_10356175 3300025949 Bacteria 1492
135 Ga0207668_10158437 3300025972 Bacteria 1761
136 Ga0207703_10239198 3300026035 Bacteria 1631
137 Ga0207702_10017937 3300026078 Bacteria 5856
138 Ga0207641_10110195 3300026088 Bacteria 2439
139 Ga0207641_10144497 3300026088 Bacteria 2150
140 Ga0207641_10183761 3300026088 Bacteria 1917
141 Ga0207676_10082309 3300026095 Bacteria 2617
142 Ga0207683_10000856 3300026121 Bacteria 27919
143 Ga0265356_1000100 3300028017 Bacteria 14645
144 Ga0268266_10576859 3300028379 Unclassified 1079
145 Ga0265338_10181418 3300028800 Bacteria 1604
146 Ga0265762_1002087 3300030760 Unclassified 3642
147 Ga0265762_1003561 3300030760 Unclassified 2791
148 Ga0265330_10043905 3300031235 Bacteria 1976
149 Ga0265328_10006529 3300031239 Bacteria 4921
150 Ga0265325_10004766 3300031241 Bacteria 8500
151 Ga0265331_10024549 3300031250 Bacteria 3048
152 Ga0265316_10032368 3300031344 Bacteria 4267
153 Ga0373943_0159648 3300035170 Bacteria 1227
154 Ga0373947_0097709 3300035725 Bacteria 1841
155 Ga0373937_0118129 3300036401 Bacteria 2470
156 Ga0373937_0415855 3300036401 Unclassified 1276
157 Ga0373925_0148434 3300037068 Unclassified 1839
158 Ga0395899_0076561 3300037312 Bacteria 2442
159 Ga0436365_0023407 3300039437 Unclassified 1700
160 Ga0436365_0238569 3300039437 Bacteria 4459
161 Ga0451577_0241121 3300042876 Bacteria 1636
162 Ga0453683_0102463 3300044673 Bacteria 1797
163 Ga0453684_0671538 3300044712 Unclassified 1129
164 Ga0451576_0017785 3300045051 Bacteria 7809
165 Ga0495580_0024897 3300046472 Bacteria 4375
166 Ga0495628_0187399 3300046516 Bacteria 1563
167 Ga0495630_0000186 3300046517 Bacteria 48315
168 Ga0495666_0000698 3300046526 Bacteria 15237
169 Ga0495640_0086735 3300046533 Bacteria 2072
170 Ga0495586_0000050 3300046535 Bacteria 70669
171 Ga0495634_0056173 3300046642 Unclassified 2631
172 Ga0495647_0010742 3300046681 Unclassified 3124
173 Ga0495613_0235942 3300046689 Unclassified 1280
174 Ga0495613_0304511 3300046689 Unclassified 1103
175 Ga0495674_0001850 3300047319 Bacteria 20844
176 Ga0495676_0036314 3300047321 Unclassified 4116
177 Ga0495602_0084275 3300048088 Bacteria 2660
178 Ga0496100_0065998 3300048903 Bacteria 2399
179 Ga0496100_0103362 3300048903 Unclassified 1967
180 Ga0496101_0031544 3300048904 Bacteria 3726
181 Ga0496102_0008892 3300048905 Bacteria 8619
182 Ga0496104_0010488 3300048907 Bacteria 8278
183 Ga0496104_0028497 3300048907 Bacteria 5176
184 Ga0496104_0144393 3300048907 Bacteria 2285
185 Ga0496105_0047559 3300048908 Bacteria 3540
186 Ga0496106_0038865 3300048909 Bacteria 3563
187 Ga0496106_0109827 3300048909 Unclassified 2146
188 Ga0496106_0264820 3300048909 Bacteria 1376
189 Ga0496107_0064183 3300048910 Bacteria 2662
190 Ga0496107_0195298 3300048910 Bacteria 1504
191 Ga0496108_0132423 3300048911 Bacteria 2143
192 Ga0496108_0166872 3300048911 Bacteria 1904
193 Ga0496110_0043741 3300048913 Bacteria 3911
194 Ga0496112_0008837 3300048915 Bacteria 9038
195 Ga0496112_0097473 3300048915 Unclassified 2911
196 Ga0496112_0115427 3300048915 Bacteria 2656
197 Ga0496114_0006103 3300048917 Bacteria 9490
198 Ga0496114_0101525 3300048917 Bacteria 2456
199 Ga0496115_0002300 3300048918 Bacteria 13680
200 Ga0496115_0051312 3300048918 Bacteria 3308
201 nmdc:mga0n895_10001_c1 3300050512 Bacteria 8349
202 nmdc:mga0rr50_57575_c1 3300050513 Bacteria 2908
203 nmdc:mga08x19_60465_c1 3300050514 Bacteria 2454
204 nmdc:mga0a205_168061_c1 3300050515 Bacteria 2089
205 Ga0495601_0006344 3300053077 Bacteria 6911
206 Ga0495619_0035269 3300053085 Bacteria 3253
207 Ga0070709_10019136
208 Ga0065712_10075810
209 Ga0065707_10128329
210 Ga0070683_100010099
211 Ga0070670_100026018
212 Ga0070670_100075251
213 Ga0070670_100089988
214 Ga0070670_100225881
215 Ga0070666_10235083
216 Ga0070680_100298644
217 Ga0068868_100424562
218 Ga0070692_10124462
219 Ga0070675_100066609
220 Ga0070667_100023579
221 Ga0070703_10013346
222 Ga0070709_10078009
223 Ga0070694_100095356
224 Ga0070708_100002285
225 Ga0070708_100008515
226 Ga0070708_100047277
227 Ga0070708_100137660
228 Ga0070706_100005601
229 Ga0070706_100023534
230 Ga0070706_100057235
231 Ga0070706_100060445
232 Ga0070707_100002539
233 Ga0070707_100010324
234 Ga0070707_100253484
235 Ga0070698_100002494
236 Ga0070698_100013352
237 Ga0070698_100188771
238 Ga0070699_100001174
239 Ga0070699_100001347
240 Ga0070699_100021102
241 Ga0070699_100193606
242 Ga0070679_100041593
243 Ga0070697_100004987
244 Ga0070697_100239567
245 Ga0068853_100031364
246 Ga0070672_100073680
247 Ga0070695_100014728
248 Ga0070696_100002004
249 Ga0070696_100361106
250 Ga0070693_100075689
251 Ga0070665_100233389
252 Ga0068859_100013558
253 Ga0068864_100070757
254 Ga0068851_10019740
255 Ga0068863_100124445
256 Ga0068863_100162205
257 Ga0070717_10002436
258 Ga0070715_10137734
259 Ga0097621_100013118
260 Ga0068871_100002700
261 Ga0068871_100015971
262 Ga0075428_100095200
263 Ga0075428_100110039
264 Ga0075434_100000074
265 Ga0075436_100069770
266 Ga0097620_100013558
267 Ga0075435_100033616
268 Ga0105240_10136820
269 Ga0105245_10238716
270 Ga0105247_10071869
271 Ga0105247_10317887
272 Ga0105243_10043678
273 Ga0105241_10006197
274 Ga0105241_10188204
275 Ga0105248_10030863
276 Ga0105248_10082397
277 Ga0105248_10090669
278 Ga0105237_10143024
279 Ga0105238_10003254
280 Ga0105249_10077581
281 Ga0105239_10377529
282 Ga0157370_10063178
283 Ga0157374_10027365
284 Ga0157374_10041521
285 Ga0157374_10051871
286 Ga0157374_10206657
287 Ga0157374_10329163
288 Ga0157374_10616932
289 Ga0157378_10019592
290 Ga0157378_10036461
291 Ga0163162_10011315
292 Ga0163162_10297977
293 Ga0163162_10644227
294 Ga0157372_10038686
295 Ga0157375_10469700
296 Ga0163163_10009123
297 Ga0163163_10327776
298 Ga0157380_10658800
299 Ga0157379_10001230
300 Ga0157379_10012799
301 Ga0157379_10162726
302 Ga0157376_10015365
303 Ga0157376_10155073
304 Ga0157376_10160558
305 Ga0157376_10170505
306 Ga0157376_10673913
307 Ga0182006_1020095
308 Ga0163161_10087057
309 Ga0207656_10118174
310 Ga0207642_10109217
311 Ga0207680_10217287
312 Ga0207699_10131428
313 Ga0207699_10307001
314 Ga0207684_10000203
315 Ga0207684_10002559
316 Ga0207684_10118099
317 Ga0207684_10238601
318 Ga0207654_10110162
319 Ga0207695_10131922
320 Ga0207657_10002104
321 Ga0207652_10063346
322 Ga0207652_10127356
323 Ga0207646_10001084
324 Ga0207646_10024906
325 Ga0207694_10119893
326 Ga0207659_10042468
327 Ga0207687_10078002
328 Ga0207690_10240789
329 Ga0207706_10066597
330 Ga0207706_10495085
331 Ga0207686_10106411
332 Ga0207686_10169817
333 Ga0207704_10022764
334 Ga0207704_10128628
335 Ga0207665_10022582
336 Ga0207665_10025663
337 Ga0207665_10172343
338 Ga0207691_10005419
339 Ga0207711_10092060
340 Ga0207667_10356175
341 Ga0207668_10158437
342 Ga0207703_10239198
343 Ga0207702_10017937
344 Ga0207641_10110195
345 Ga0207641_10144497
346 Ga0207641_10183761
347 Ga0207676_10082309
348 Ga0207683_10000856
349 Ga0265356_1000100
350 Ga0268266_10576859
351 Ga0265338_10181418
352 Ga0265762_1002087
353 Ga0265762_1003561
354 Ga0265330_10043905
355 Ga0265328_10006529
356 Ga0265325_10004766
357 Ga0265331_10024549
358 Ga0265316_10032368
359 Ga0373943_0159648
360 Ga0373947_0097709
361 Ga0373937_0118129
362 Ga0373937_0415855
363 Ga0373925_0148434
364 Ga0395899_0076561
365 Ga0436365_0023407
366 Ga0436365_0238569
367 Ga0451577_0241121
368 Ga0453683_0102463
369 Ga0453684_0671538
370 Ga0451576_0017785
371 Ga0495580_0024897
372 Ga0495628_0187399
373 Ga0495630_0000186
374 Ga0495666_0000698
375 Ga0495640_0086735
376 Ga0495586_0000050
377 Ga0495634_0056173
378 Ga0495647_0010742
379 Ga0495613_0235942
380 Ga0495613_0304511
381 Ga0495674_0001850
382 Ga0495676_0036314
383 Ga0495602_0084275
384 Ga0496100_0065998
385 Ga0496100_0103362
386 Ga0496101_0031544
387 Ga0496102_0008892
388 Ga0496104_0010488
389 Ga0496104_0028497
390 Ga0496104_0144393
391 Ga0496105_0047559
392 Ga0496106_0038865
393 Ga0496106_0109827
394 Ga0496106_0264820
395 Ga0496107_0064183
396 Ga0496107_0195298
397 Ga0496108_0132423
398 Ga0496108_0166872
399 Ga0496110_0043741
400 Ga0496112_0008837
401 Ga0496112_0097473
402 Ga0496112_0115427
403 Ga0496114_0006103
404 Ga0496114_0101525
405 Ga0496115_0002300
406 Ga0496115_0051312
407 nmdc:mga0n895_10001_c1
408 nmdc:mga0rr50_57575_c1
409 nmdc:mga08x19_60465_c1
410 nmdc:mga0a205_168061_c1
411 Ga0495601_0006344
412 Ga0495619_0035269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

98

250

0.74

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

98

358

0.73

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

100

364

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a6g-assembly1.cif.gz_A structural characterization of l-proline amide hydrolase from pseudomonas syringae 0.8912 36 329
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.8894 36 329
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.8885 38 329
1xqx-assembly1.cif.gz_A crystal structure of f1-mutant s105a complex with pck 0.8878 36 329
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.8876 36 329
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9007 45 331 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8978 38 159 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8945 45 331 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8894 36 329 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8878 47 151 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A0U3H5F3-F1-model_v4 Proline iminopeptidase 0.9557 34 154 GO:0006508
GO:0008233
AF-A0A2T0QJH6-F1-model_v4 Alpha/beta hydrolase family protein 0.9415 38 154 GO:0016787
AF-A0A2E1YV78-F1-model_v4 deleted 0.9247 40 163
AF-T2RF85-F1-model_v4 deleted 0.9225 40 173
AF-A0A659YXS7-F1-model_v4 deleted 0.9176 34 154

Map