F314702

General Info

Members Datasets Scaffolds Average Seq Length
206 160 412 133

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100269716|Ga0068869_1002697162
Length 150
Sequence MTARAIERRLLQGVVAVACLVPLTAGTRGVLRGAASVGAIAITPDLDSHFRYMSGIFLMMGLAFVSTIPGIEHKGPRFRLLGAMVVLGGLARALSWFEVGAPSAGHRFGLAMELGVVPLLMLWQARVARKSSPERGGGPCSSMVEGPQAK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
114 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
115 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
116 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
117 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
118 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
119 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
122 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
123 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
124 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
125 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
126 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
127 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
130 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
131 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
132 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
133 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
134 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
135 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
151 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
155 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
160 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.53
Nodule 0
Rhizoplane 2.91
Rhizosphere 77.18
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100269716 3300005334 Bacteria 1365
2 JGI24752J21851_1000372 3300001976 Bacteria 6242
3 JGI24749J21850_1000113 3300002076 Bacteria 13512
4 JGI24751J29686_10000022 3300002459 Bacteria 104477
5 JGI25165J46597_1000208 3300003214 Bacteria 84386
6 Ga0065704_10102855 3300005289 Bacteria 2191
7 Ga0070676_10784740 3300005328 Bacteria 702
8 Ga0070670_100000006 3300005331 Bacteria 319420
9 Ga0070670_100000027 3300005331 Bacteria 186072
10 Ga0068869_100244067 3300005334 Bacteria 1432
11 Ga0070666_10251579 3300005335 Bacteria 1251
12 Ga0070660_100664016 3300005339 Bacteria 873
13 Ga0070668_100021055 3300005347 Bacteria 4928
14 Ga0070668_100051319 3300005347 Bacteria 3178
15 Ga0070669_101060241 3300005353 Bacteria 697
16 Ga0070667_100000638 3300005367 Bacteria 34017
17 Ga0070667_100002925 3300005367 Bacteria 14674
18 Ga0070708_101217687 3300005445 Bacteria 704
19 Ga0070699_100759349 3300005518 Bacteria 887
20 Ga0070679_100220807 3300005530 Bacteria 1856
21 Ga0068853_101547183 3300005539 Bacteria 642
22 Ga0068853_101737711 3300005539 Bacteria 605
23 Ga0070665_101092791 3300005548 Bacteria 809
24 Ga0070665_101539843 3300005548 Bacteria 673
25 Ga0068857_100328306 3300005577 Bacteria 1413
26 Ga0068852_101497630 3300005616 Bacteria 697
27 Ga0068852_101624753 3300005616 Bacteria 669
28 Ga0068859_100005110 3300005617 Bacteria 13329
29 Ga0068859_100131582 3300005617 Unclassified 2573
30 Ga0068859_100351047 3300005617 Bacteria 1570
31 Ga0068864_100000014 3300005618 Bacteria 308927
32 Ga0068864_100000083 3300005618 Bacteria 100972
33 Ga0068861_100171776 3300005719 Bacteria 1797
34 Ga0068863_100000025 3300005841 Bacteria 186072
35 Ga0068858_100001193 3300005842 Bacteria 26901
36 Ga0068862_100000007 3300005844 Bacteria 313933
37 Ga0068862_100000027 3300005844 Bacteria 186072
38 Ga0068862_100212750 3300005844 Bacteria 1747
39 Ga0068871_100197858 3300006358 Bacteria 1734
40 Ga0097620_100005110 3300006931 Bacteria 13329
41 Ga0097620_100131591 3300006931 Unclassified 2573
42 Ga0097620_100351040 3300006931 Bacteria 1570
43 Ga0105251_10000554 3300009011 Bacteria 35071
44 Ga0105245_10003076 3300009098 Bacteria 14938
45 Ga0105243_10079627 3300009148 Bacteria 2670
46 Ga0105248_10000026 3300009177 Bacteria 257155
47 Ga0105248_10000113 3300009177 Bacteria 91128
48 Ga0105237_10337331 3300009545 Bacteria 1512
49 Ga0105238_10030557 3300009551 Bacteria 5484
50 Ga0105249_10000123 3300009553 Bacteria 104747
51 Ga0105249_10074400 3300009553 Bacteria 3144
52 Ga0105239_10196473 3300010375 Bacteria 2259
53 Ga0105239_12828964 3300010375 Unclassified 566
54 Ga0105246_11262091 3300011119 Bacteria 683
55 Ga0157369_10462788 3300013105 Bacteria 1313
56 Ga0157374_10306707 3300013296 Bacteria 1571
57 Ga0157378_10012990 3300013297 Bacteria 7285
58 Ga0157378_10064942 3300013297 Bacteria 3266
59 Ga0163162_10063123 3300013306 Bacteria 3746
60 Ga0163162_10103832 3300013306 Bacteria 2936
61 Ga0182008_10237648 3300014497 Bacteria 936
62 Ga0183363_1008 3300015690 Bacteria 194027
63 Ga0163161_11527749 3300017792 Bacteria 587
64 Ga0209233_1000186 3300025261 Bacteria 133572
65 Ga0207713_1000615 3300025735 Bacteria 35051
66 Ga0207645_10364094 3300025907 Bacteria 969
67 Ga0207652_10162681 3300025921 Bacteria 2001
68 Ga0207694_10094470 3300025924 Bacteria 2363
69 Ga0207650_10000023 3300025925 Bacteria 308148
70 Ga0207650_10000056 3300025925 Bacteria 157972
71 Ga0207687_10001168 3300025927 Bacteria 17930
72 Ga0207690_10303513 3300025932 Bacteria 1250
73 Ga0207709_10101522 3300025935 Bacteria 1903
74 Ga0207704_11223533 3300025938 Bacteria 641
75 Ga0207711_10000004 3300025941 Bacteria 870636
76 Ga0207711_10022350 3300025941 Bacteria 5287
77 Ga0207711_10099155 3300025941 Bacteria 2575
78 Ga0207689_11027327 3300025942 Bacteria 695
79 Ga0207667_10644875 3300025949 Bacteria 1065
80 Ga0207651_10318873 3300025960 Bacteria 1299
81 Ga0207668_10035708 3300025972 Bacteria 3312
82 Ga0207668_10054279 3300025972 Bacteria 2781
83 Ga0207640_10029577 3300025981 Bacteria 3364
84 Ga0207658_10002176 3300025986 Bacteria 14570
85 Ga0207658_10056527 3300025986 Bacteria 2912
86 Ga0207677_10417620 3300026023 Bacteria 1142
87 Ga0207703_10000624 3300026035 Bacteria 35589
88 Ga0207639_10640769 3300026041 Bacteria 982
89 Ga0207641_10000018 3300026088 Bacteria 298209
90 Ga0207676_10000017 3300026095 Bacteria 308709
91 Ga0207676_10000027 3300026095 Bacteria 245868
92 Ga0207674_10265157 3300026116 Bacteria 1665
93 Ga0207675_100000427 3300026118 Bacteria 40735
94 Ga0268266_10293746 3300028379 Bacteria 1514
95 Ga0268266_11272200 3300028379 Bacteria 711
96 Ga0268265_10000002 3300028380 Bacteria 1035381
97 Ga0268265_10000042 3300028380 Bacteria 186086
98 Ga0268265_10160100 3300028380 Bacteria 1911
99 Ga0307509_10107005 3300031507 Bacteria 2814
100 Ga0307508_10000405 3300031616 Bacteria 51700
101 Ga0307413_11132802 3300031824 Unclassified 677
102 Ga0373923_0127991 3300035111 Bacteria 1139
103 Ga0373947_0077225 3300035725 Bacteria 2054
104 Ga0373925_0709934 3300037068 Bacteria 829
105 Ga0395899_0022327 3300037312 Bacteria 4799
106 Ga0395900_0073039 3300037418 Bacteria 3526
107 Ga0395898_0036807 3300037466 Bacteria 4857
108 Ga0395905_0058286 3300037471 Bacteria 3611
109 Ga0436364_0078621 3300037853 Unclassified 527
110 Ga0395901_0009939 3300038443 Bacteria 9645
111 Ga0451789_0263400 3300041443 Bacteria 540
112 Ga0495638_0000014 3300046460 Bacteria 417060
113 Ga0495638_0001805 3300046460 Bacteria 18647
114 Ga0495585_0069683 3300046492 Bacteria 1919
115 Ga0495607_0005650 3300046501 Bacteria 8913
116 Ga0495583_0000072 3300046506 Bacteria 182057
117 Ga0495583_0273343 3300046506 Bacteria 674
118 Ga0495632_0000171 3300046519 Bacteria 66639
119 Ga0495637_0179962 3300046520 Bacteria 784
120 Ga0495643_0069327 3300046522 Bacteria 1853
121 Ga0495643_0245544 3300046522 Bacteria 838
122 Ga0495648_0000021 3300046524 Bacteria 246945
123 Ga0495648_0015037 3300046524 Bacteria 5636
124 Ga0495609_0152029 3300046538 Bacteria 984
125 Ga0495597_0003051 3300046542 Bacteria 10084
126 Ga0495622_0177787 3300046557 Bacteria 955
127 Ga0495633_0008000 3300046558 Bacteria 6021
128 Ga0495633_0033841 3300046558 Bacteria 2461
129 Ga0495668_0103417 3300046616 Bacteria 1558
130 Ga0495625_0000615 3300046660 Bacteria 51688
131 Ga0495625_0041156 3300046660 Bacteria 3365
132 Ga0495625_0657978 3300046660 Bacteria 623
133 Ga0495624_0781359 3300046690 Bacteria 565
134 Ga0495670_0068613 3300046691 Bacteria 1792
135 Ga0495671_0000028 3300046692 Bacteria 234938
136 Ga0495673_0000058 3300047469 Bacteria 235044
137 Ga0495681_0379092 3300047470 Bacteria 532
138 Ga0495686_0000650 3300047472 Bacteria 47482
139 Ga0495686_0005433 3300047472 Bacteria 10061
140 Ga0496101_0030355 3300048904 Bacteria 3789
141 Ga0496102_1574893 3300048905 Bacteria 575
142 Ga0496103_0026083 3300048906 Bacteria 3536
143 Ga0496112_0585349 3300048915 Bacteria 1048
144 Ga0496113_0139657 3300048916 Bacteria 1906
145 Ga0496117_0002463 3300048920 Bacteria 23295
146 Ga0496118_0000262 3300048921 Bacteria 92154
147 Ga0496121_0035017 3300048924 Bacteria 4506
148 Ga0496121_0286209 3300048924 Bacteria 1125
149 Ga0496125_0093778 3300048928 Bacteria 2239
150 Ga0496125_0689358 3300048928 Bacteria 544
151 Ga0501290_000300 3300049513 Bacteria 8068
152 Ga0501292_000004 3300049515 Bacteria 159565
153 Ga0501294_000688 3300049517 Bacteria 3787
154 Ga0501300_010417 3300049523 Bacteria 1356
155 Ga0501301_001486 3300049524 Bacteria 1485
156 Ga0501206_003060 3300049653 Bacteria 2119
157 Ga0501222_000485 3300049662 Bacteria 5895
158 Ga0501223_001043 3300049663 Bacteria 6544
159 Ga0501224_000571 3300049664 Bacteria 4520
160 Ga0501227_006636 3300049665 Bacteria 2483
161 Ga0501233_014807 3300049668 Bacteria 1598
162 Ga0501235_000920 3300049669 Bacteria 6070
163 Ga0501259_001182 3300049688 Bacteria 4350
164 Ga0501261_000569 3300049690 Bacteria 4697
165 Ga0501221_017784 3300049704 Bacteria 1361
166 Ga0501225_0001612 3300049705 Bacteria 7059
167 Ga0501245_007599 3300049708 Bacteria 1533
168 Ga0501274_015147 3300049771 Bacteria 754
169 Ga0501279_000005 3300049775 Bacteria 153858
170 Ga0501280_000038 3300049776 Bacteria 38694
171 Ga0501281_00153 3300049777 Bacteria 8069
172 Ga0501282_000512 3300049778 Bacteria 4588
173 Ga0501283_023771 3300049779 Bacteria 995
174 Ga0501035_1564382 3300049822 Bacteria 501
175 Ga0500643_000066 3300053087 Bacteria 119317
176 Ga0500643_006752 3300053087 Bacteria 4739
177 Ga0500647_0006999 3300053091 Bacteria 4810
178 Ga0500651_0000538 3300053093 Bacteria 19288
179 Ga0500566_0000251 3300053094 Bacteria 28795
180 Ga0500566_0031423 3300053094 Bacteria 3096
181 Ga0500641_0029902 3300053096 Bacteria 2137
182 Ga0500641_0184904 3300053096 Bacteria 894
183 Ga0500562_007597 3300053108 Bacteria 2734
184 Ga0500618_004518 3300053125 Bacteria 4413
185 Ga0500642_0007878 3300053130 Bacteria 3607
186 Ga0500652_111414 3300053131 Bacteria 1144
187 Ga0500655_000422 3300053133 Bacteria 8829
188 Ga0500658_0000708 3300053134 Bacteria 13778
189 Ga0500559_0135531 3300053136 Bacteria 1151
190 Ga0500559_0351727 3300053136 Bacteria 689
191 Ga0500559_0455768 3300053136 Bacteria 591
192 Ga0500568_0146711 3300053139 Bacteria 874
193 Ga0500577_0021568 3300053142 Bacteria 2124
194 Ga0500590_009100 3300053148 Bacteria 4983
195 Ga0500616_0028723 3300053153 Bacteria 3064
196 Ga0500622_0011348 3300053156 Bacteria 4857
197 Ga0500622_0291367 3300053156 Bacteria 699
198 Ga0500624_000036 3300053157 Bacteria 94678
199 Ga0500639_194206 3300053163 Bacteria 880
200 Ga0500636_0113479 3300053177 Bacteria 1528
201 Ga0500636_0291437 3300053177 Bacteria 809
202 Ga0500570_003970 3300053724 Bacteria 7713
203 Ga0500645_036143 3300053730 Bacteria 1470
204 Ga0500645_057162 3300053730 Bacteria 1131
205 2585259770 2582581305 Bacteria 4895574
206 2946790901 2946787523 Bacteria 4366789
207 Ga0068869_100269716
208 JGI24752J21851_1000372
209 JGI24749J21850_1000113
210 JGI24751J29686_10000022
211 JGI25165J46597_1000208
212 Ga0065704_10102855
213 Ga0070676_10784740
214 Ga0070670_100000006
215 Ga0070670_100000027
216 Ga0068869_100244067
217 Ga0070666_10251579
218 Ga0070660_100664016
219 Ga0070668_100021055
220 Ga0070668_100051319
221 Ga0070669_101060241
222 Ga0070667_100000638
223 Ga0070667_100002925
224 Ga0070708_101217687
225 Ga0070699_100759349
226 Ga0070679_100220807
227 Ga0068853_101547183
228 Ga0068853_101737711
229 Ga0070665_101092791
230 Ga0070665_101539843
231 Ga0068857_100328306
232 Ga0068852_101497630
233 Ga0068852_101624753
234 Ga0068859_100005110
235 Ga0068859_100131582
236 Ga0068859_100351047
237 Ga0068864_100000014
238 Ga0068864_100000083
239 Ga0068861_100171776
240 Ga0068863_100000025
241 Ga0068858_100001193
242 Ga0068862_100000007
243 Ga0068862_100000027
244 Ga0068862_100212750
245 Ga0068871_100197858
246 Ga0097620_100005110
247 Ga0097620_100131591
248 Ga0097620_100351040
249 Ga0105251_10000554
250 Ga0105245_10003076
251 Ga0105243_10079627
252 Ga0105248_10000026
253 Ga0105248_10000113
254 Ga0105237_10337331
255 Ga0105238_10030557
256 Ga0105249_10000123
257 Ga0105249_10074400
258 Ga0105239_10196473
259 Ga0105239_12828964
260 Ga0105246_11262091
261 Ga0157369_10462788
262 Ga0157374_10306707
263 Ga0157378_10012990
264 Ga0157378_10064942
265 Ga0163162_10063123
266 Ga0163162_10103832
267 Ga0182008_10237648
268 Ga0183363_1008
269 Ga0163161_11527749
270 Ga0209233_1000186
271 Ga0207713_1000615
272 Ga0207645_10364094
273 Ga0207652_10162681
274 Ga0207694_10094470
275 Ga0207650_10000023
276 Ga0207650_10000056
277 Ga0207687_10001168
278 Ga0207690_10303513
279 Ga0207709_10101522
280 Ga0207704_11223533
281 Ga0207711_10000004
282 Ga0207711_10022350
283 Ga0207711_10099155
284 Ga0207689_11027327
285 Ga0207667_10644875
286 Ga0207651_10318873
287 Ga0207668_10035708
288 Ga0207668_10054279
289 Ga0207640_10029577
290 Ga0207658_10002176
291 Ga0207658_10056527
292 Ga0207677_10417620
293 Ga0207703_10000624
294 Ga0207639_10640769
295 Ga0207641_10000018
296 Ga0207676_10000017
297 Ga0207676_10000027
298 Ga0207674_10265157
299 Ga0207675_100000427
300 Ga0268266_10293746
301 Ga0268266_11272200
302 Ga0268265_10000002
303 Ga0268265_10000042
304 Ga0268265_10160100
305 Ga0307509_10107005
306 Ga0307508_10000405
307 Ga0307413_11132802
308 Ga0373923_0127991
309 Ga0373947_0077225
310 Ga0373925_0709934
311 Ga0395899_0022327
312 Ga0395900_0073039
313 Ga0395898_0036807
314 Ga0395905_0058286
315 Ga0436364_0078621
316 Ga0395901_0009939
317 Ga0451789_0263400
318 Ga0495638_0000014
319 Ga0495638_0001805
320 Ga0495585_0069683
321 Ga0495607_0005650
322 Ga0495583_0000072
323 Ga0495583_0273343
324 Ga0495632_0000171
325 Ga0495637_0179962
326 Ga0495643_0069327
327 Ga0495643_0245544
328 Ga0495648_0000021
329 Ga0495648_0015037
330 Ga0495609_0152029
331 Ga0495597_0003051
332 Ga0495622_0177787
333 Ga0495633_0008000
334 Ga0495633_0033841
335 Ga0495668_0103417
336 Ga0495625_0000615
337 Ga0495625_0041156
338 Ga0495625_0657978
339 Ga0495624_0781359
340 Ga0495670_0068613
341 Ga0495671_0000028
342 Ga0495673_0000058
343 Ga0495681_0379092
344 Ga0495686_0000650
345 Ga0495686_0005433
346 Ga0496101_0030355
347 Ga0496102_1574893
348 Ga0496103_0026083
349 Ga0496112_0585349
350 Ga0496113_0139657
351 Ga0496117_0002463
352 Ga0496118_0000262
353 Ga0496121_0035017
354 Ga0496121_0286209
355 Ga0496125_0093778
356 Ga0496125_0689358
357 Ga0501290_000300
358 Ga0501292_000004
359 Ga0501294_000688
360 Ga0501300_010417
361 Ga0501301_001486
362 Ga0501206_003060
363 Ga0501222_000485
364 Ga0501223_001043
365 Ga0501224_000571
366 Ga0501227_006636
367 Ga0501233_014807
368 Ga0501235_000920
369 Ga0501259_001182
370 Ga0501261_000569
371 Ga0501221_017784
372 Ga0501225_0001612
373 Ga0501245_007599
374 Ga0501274_015147
375 Ga0501279_000005
376 Ga0501280_000038
377 Ga0501281_00153
378 Ga0501282_000512
379 Ga0501283_023771
380 Ga0501035_1564382
381 Ga0500643_000066
382 Ga0500643_006752
383 Ga0500647_0006999
384 Ga0500651_0000538
385 Ga0500566_0000251
386 Ga0500566_0031423
387 Ga0500641_0029902
388 Ga0500641_0184904
389 Ga0500562_007597
390 Ga0500618_004518
391 Ga0500642_0007878
392 Ga0500652_111414
393 Ga0500655_000422
394 Ga0500658_0000708
395 Ga0500559_0135531
396 Ga0500559_0351727
397 Ga0500559_0455768
398 Ga0500568_0146711
399 Ga0500577_0021568
400 Ga0500590_009100
401 Ga0500616_0028723
402 Ga0500622_0011348
403 Ga0500622_0291367
404 Ga0500624_000036
405 Ga0500639_194206
406 Ga0500636_0113479
407 Ga0500636_0291437
408 Ga0500570_003970
409 Ga0500645_036143
410 Ga0500645_057162
411 2585259770
412 2946790901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14248

DUF4345

Domain of unknown function (DUF4345)

10

124

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6643 4 120
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6363 4 120
1x8z-assembly1.cif.gz_A-2 crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.6164 7 120
1x8z-assembly3.cif.gz_A crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.6164 7 120
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.6029 3 125
ID Description Score Start End Superfamily
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7532 7 120 1.20.120.550
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7359 7 118 1.20.1280.290
af_L7N692_9_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7342 11 115 1.20.120.550
af_Q9N4P4_40_210_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.724 3 119 1.20.120.550
af_L7N692_9_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7159 11 115 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A5E4NUL5-F1-model_v4 DUF4345 domain-containing protein 0.9665 3 130 GO:0016020
AF-A0A4R7CAT3-F1-model_v4 Uncharacterized protein DUF4345 0.9638 3 129 GO:0016020
AF-A0A0J6ST26-F1-model_v4 Membrane protein 0.9625 3 131 GO:0016020
AF-A0A7G5IGW0-F1-model_v4 DUF4345 domain-containing protein 0.9624 3 126 GO:0016020
AF-A0A509EL67-F1-model_v4 DUF4345 domain-containing protein 0.9615 3 127 GO:0016020

Map