F314651

General Info

Members Datasets Scaffolds Average Seq Length
206 133 412 172

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10183366|Ga0070658_101833662
Length 200
Sequence MLPRRCGRRYGRCQPASRSGREVAATIGLVNVAASVRIRSESKVDRQAIRAVTEAAFGRPEEADLIERLRAERAVLVSLVALMGQRLIGHVLFSRMLIESAHGSVPAVALAPVAVLPEVQRQGVGGALIRGGLERLRARDERIVIVVGHPAYYPRFGFAASAARALVHPFPPDAFMALELAPGALDNLKGTVNYAKAFRL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 19.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10183366 3300005327 Bacteria 1762
2 MBSR1b_contig_7594409 2162886012 Bacteria 1291
3 JGI25406J46586_10000181 3300003203 Bacteria 28391
4 Ga0065712_10391154 3300005290 Unclassified 741
5 Ga0070676_10605879 3300005328 Unclassified 790
6 Ga0070690_100000549 3300005330 Bacteria 18791
7 Ga0068869_100082785 3300005334 Bacteria 2399
8 Ga0068869_100637741 3300005334 Bacteria 903
9 Ga0070666_10022385 3300005335 Bacteria 4104
10 Ga0070666_10561212 3300005335 Bacteria 831
11 Ga0070689_100177194 3300005340 Bacteria 1730
12 Ga0070669_100010552 3300005353 Bacteria 6558
13 Ga0070675_100001050 3300005354 Bacteria 19912
14 Ga0070675_100056746 3300005354 Bacteria 3228
15 Ga0070675_100647795 3300005354 Bacteria 960
16 Ga0070671_100551187 3300005355 Unclassified 994
17 Ga0070671_100921178 3300005355 Bacteria 764
18 Ga0070674_100418107 3300005356 Bacteria 1099
19 Ga0070673_100237503 3300005364 Unclassified 1583
20 Ga0070688_100265579 3300005365 Bacteria 1227
21 Ga0070714_100097510 3300005435 Bacteria 2585
22 Ga0070705_100691516 3300005440 Bacteria 800
23 Ga0070700_100595962 3300005441 Bacteria 865
24 Ga0068867_100481608 3300005459 Bacteria 1063
25 Ga0070706_100642999 3300005467 Bacteria 985
26 Ga0070706_100997691 3300005467 Bacteria 772
27 Ga0070698_100000383 3300005471 Bacteria 46369
28 Ga0070699_100031006 3300005518 Bacteria 4616
29 Ga0070672_100263885 3300005543 Bacteria 1453
30 Ga0070672_100669436 3300005543 Bacteria 907
31 Ga0070686_100008481 3300005544 Bacteria 5756
32 Ga0070686_100082439 3300005544 Unclassified 2133
33 Ga0070696_100719109 3300005546 Unclassified 815
34 Ga0070665_100252817 3300005548 Bacteria 1763
35 Ga0068855_100094327 3300005563 Bacteria 3451
36 Ga0068855_100321874 3300005563 Unclassified 1709
37 Ga0068855_101446391 3300005563 Unclassified 707
38 Ga0068854_100024237 3300005578 Bacteria 4152
39 Ga0068854_100112157 3300005578 Unclassified 2058
40 Ga0070702_100184676 3300005615 Bacteria 1367
41 Ga0068852_100406027 3300005616 Bacteria 1341
42 Ga0068859_100911024 3300005617 Bacteria 964
43 Ga0068860_100065123 3300005843 Bacteria 3461
44 Ga0081455_10133732 3300005937 Bacteria 1935
45 Ga0081539_10001078 3300005985 Bacteria 49685
46 Ga0075428_100000331 3300006844 Bacteria 46981
47 Ga0075428_101522911 3300006844 Unclassified 700
48 Ga0075431_100029087 3300006847 Bacteria 5684
49 Ga0075433_10286669 3300006852 Unclassified 1458
50 Ga0075434_100309889 3300006871 Bacteria 1599
51 Ga0075434_100458095 3300006871 Bacteria 1296
52 Ga0075434_100532879 3300006871 Unclassified 1194
53 Ga0097620_100392259 3300006931 Bacteria 1484
54 Ga0097620_100910975 3300006931 Bacteria 964
55 Ga0075435_100274833 3300007076 Bacteria 1438
56 Ga0105240_10142406 3300009093 Unclassified 2865
57 Ga0111539_10001187 3300009094 Bacteria 34615
58 Ga0111539_10343525 3300009094 Bacteria 1737
59 Ga0111539_11311915 3300009094 Bacteria 840
60 Ga0105245_10050126 3300009098 Unclassified 3740
61 Ga0114129_10304008 3300009147 Bacteria 2125
62 Ga0114129_10927292 3300009147 Unclassified 1102
63 Ga0105241_10056346 3300009174 Bacteria 3014
64 Ga0105241_10208905 3300009174 Bacteria 1635
65 Ga0105241_11101731 3300009174 Bacteria 748
66 Ga0105248_10267116 3300009177 Unclassified 1926
67 Ga0105248_10635623 3300009177 Unclassified 1204
68 Ga0105238_10755817 3300009551 Bacteria 986
69 Ga0163162_10008795 3300013306 Bacteria 9820
70 Ga0163162_10520345 3300013306 Bacteria 1319
71 Ga0163163_10691946 3300014325 Bacteria 1083
72 Ga0157380_10009433 3300014326 Bacteria 6990
73 Ga0157380_10319949 3300014326 Bacteria 1438
74 Ga0157380_10656302 3300014326 Bacteria 1047
75 Ga0207680_10013693 3300025903 Bacteria 4173
76 Ga0207680_10350748 3300025903 Bacteria 1037
77 Ga0207645_10215050 3300025907 Bacteria 1266
78 Ga0207684_10505309 3300025910 Bacteria 1036
79 Ga0207654_10606039 3300025911 Bacteria 782
80 Ga0207654_10975050 3300025911 Bacteria 616
81 Ga0207695_10229806 3300025913 Bacteria 1760
82 Ga0207681_10003838 3300025923 Bacteria 9324
83 Ga0207681_10489398 3300025923 Unclassified 1006
84 Ga0207659_10002879 3300025926 Bacteria 10240
85 Ga0207659_10029023 3300025926 Bacteria 3765
86 Ga0207687_10151875 3300025927 Bacteria 1768
87 Ga0207664_10235905 3300025929 Bacteria 1591
88 Ga0207644_10609329 3300025931 Bacteria 907
89 Ga0207706_10038697 3300025933 Bacteria 4231
90 Ga0207686_10133732 3300025934 Bacteria 1704
91 Ga0207670_10521548 3300025936 Bacteria 967
92 Ga0207669_10378295 3300025937 Bacteria 1102
93 Ga0207691_10299726 3300025940 Unclassified 1381
94 Ga0207691_10316177 3300025940 Bacteria 1339
95 Ga0207691_10815466 3300025940 Bacteria 784
96 Ga0207711_10318284 3300025941 Bacteria 1437
97 Ga0207711_10454254 3300025941 Bacteria 1193
98 Ga0207711_10660100 3300025941 Bacteria 976
99 Ga0207689_10103131 3300025942 Bacteria 2344
100 Ga0207689_10270288 3300025942 Bacteria 1407
101 Ga0207667_10105043 3300025949 Bacteria 2914
102 Ga0207651_10099955 3300025960 Bacteria 2150
103 Ga0207651_10179852 3300025960 Unclassified 1677
104 Ga0207640_10077939 3300025981 Unclassified 2254
105 Ga0207648_10306042 3300026089 Bacteria 1426
106 Ga0207648_10348470 3300026089 Bacteria 1335
107 Ga0207698_10368526 3300026142 Bacteria 1362
108 Ga0207698_10520544 3300026142 Bacteria 1161
109 Ga0207428_10012766 3300027907 Bacteria 7368
110 Ga0268265_10533655 3300028380 Unclassified 1111
111 Ga0268264_10006539 3300028381 Bacteria 9815
112 Ga0268264_10289013 3300028381 Bacteria 1539
113 Ga0265337_1116764 3300028556 Bacteria 724
114 Ga0265316_10976714 3300031344 Bacteria 590
115 Ga0307408_100403592 3300031548 Bacteria 1174
116 Ga0307405_10946047 3300031731 Bacteria 732
117 Ga0307409_100172198 3300031995 Bacteria 1907
118 Ga0307414_10651240 3300032004 Bacteria 950
119 Ga0307411_11764627 3300032005 Unclassified 574
120 Ga0307415_100378837 3300032126 Bacteria 1201
121 Ga0373923_0314662 3300035111 Unclassified 743
122 Ga0373937_1045911 3300036401 Bacteria 765
123 Ga0436365_0115852 3300039437 Bacteria 3603
124 Ga0436365_0473069 3300039437 Bacteria 25772
125 Ga0439453_0005029 3300041408 Bacteria 1997
126 Ga0466972_0081099 3300044658 Bacteria 1545
127 Ga0466963_0193057 3300044694 Bacteria 1423
128 Ga0495592_0204374 3300046454 Bacteria 1331
129 Ga0495650_0157143 3300046471 Bacteria 813
130 Ga0495586_0324487 3300046535 Bacteria 883
131 Ga0495645_0048980 3300046543 Unclassified 3077
132 Ga0495669_0481941 3300046684 Unclassified 603
133 Ga0495684_0317219 3300047471 Bacteria 1115
134 Ga0495686_0160115 3300047472 Unclassified 1316
135 Ga0496100_0459334 3300048903 Bacteria 977
136 Ga0496101_0168810 3300048904 Bacteria 1681
137 Ga0496103_0267758 3300048906 Bacteria 1099
138 Ga0496106_0092911 3300048909 Bacteria 2331
139 Ga0496107_0231409 3300048910 Bacteria 1375
140 Ga0496109_1301427 3300048912 Unclassified 663
141 Ga0496110_0107862 3300048913 Unclassified 2500
142 Ga0501033_0540881 3300049570 Bacteria 803
143 Ga0501036_0015042 3300049572 Bacteria 6458
144 Ga0501038_0189126 3300049574 Bacteria 1657
145 Ga0501038_0447792 3300049574 Unclassified 993
146 Ga0501038_0712334 3300049574 Unclassified 751
147 Ga0501039_0399625 3300049575 Bacteria 1079
148 Ga0501040_0007348 3300049576 Bacteria 7136
149 Ga0501040_0460630 3300049576 Unclassified 915
150 Ga0501041_0000746 3300049577 Bacteria 17441
151 Ga0501041_0032647 3300049577 Bacteria 3147
152 Ga0501042_0072737 3300049578 Bacteria 2460
153 Ga0501042_0123503 3300049578 Bacteria 1864
154 Ga0501042_0207787 3300049578 Bacteria 1412
155 Ga0501042_0287244 3300049578 Bacteria 1188
156 Ga0501046_0021736 3300049580 Bacteria 5291
157 Ga0501046_0085952 3300049580 Bacteria 2425
158 Ga0501046_0781123 3300049580 Bacteria 670
159 Ga0501071_0011401 3300049587 Bacteria 5989
160 Ga0501072_0002156 3300049588 Bacteria 14702
161 Ga0501072_0003203 3300049588 Bacteria 12293
162 Ga0501072_0043786 3300049588 Bacteria 3519
163 Ga0501072_0053892 3300049588 Bacteria 3168
164 Ga0501072_0117365 3300049588 Bacteria 2120
165 Ga0501073_0383649 3300049589 Bacteria 971
166 Ga0501074_0251030 3300049590 Bacteria 1258
167 Ga0501075_0000583 3300049591 Bacteria 22259
168 Ga0501075_0018295 3300049591 Bacteria 5070
169 Ga0501075_0020923 3300049591 Unclassified 4765
170 Ga0501075_0059299 3300049591 Bacteria 2883
171 Ga0501075_0067025 3300049591 Bacteria 2710
172 Ga0501076_0063093 3300049592 Bacteria 2952
173 Ga0501076_0103172 3300049592 Unclassified 2300
174 Ga0501076_1373284 3300049592 Unclassified 581
175 Ga0501077_0055674 3300049593 Bacteria 2511
176 Ga0501077_0105021 3300049593 Bacteria 1790
177 Ga0501077_0634321 3300049593 Bacteria 686
178 Ga0501079_0408759 3300049741 Unclassified 1065
179 Ga0501079_0923244 3300049741 Bacteria 687
180 Ga0501080_0005635 3300049742 Bacteria 11190
181 Ga0501080_0037603 3300049742 Bacteria 4521
182 Ga0501081_0003882 3300049743 Bacteria 9578
183 Ga0501081_0037193 3300049743 Bacteria 3321
184 Ga0501081_0162067 3300049743 Bacteria 1612
185 Ga0501083_0041732 3300049744 Bacteria 3111
186 Ga0501035_0134693 3300049822 Bacteria 2152
187 Ga0501045_0004432 3300049824 Bacteria 9689
188 Ga0501045_0453282 3300049824 Unclassified 953
189 nmdc:mga09592_209273_c1 3300050508 Bacteria 1689
190 nmdc:mga08y16_10042_c1 3300050511 Bacteria 9936
191 nmdc:mga08y16_483015_c1 3300050511 Unclassified 1260
192 nmdc:mga0n895_1262465_c1 3300050512 Bacteria 711
193 nmdc:mga0n895_132146_c1 3300050512 Unclassified 2521
194 nmdc:mga0rr50_97563_c1 3300050513 Bacteria 2302
195 Ga0501084_0010175 3300054114 Bacteria 7777
196 Ga0501084_0418093 3300054114 Unclassified 1133
197 Ga0590075_002044 3300059424 Bacteria 4870
198 Ga0590077_000513 3300059426 Bacteria 10721
199 Ga0501082_0005736 3300060353 Bacteria 10772
200 Ga0501082_0013125 3300060353 Bacteria 7123
201 Ga0501082_0131767 3300060353 Bacteria 2169
202 Ga0501082_0507739 3300060353 Bacteria 1054
203 Ga0501082_0658466 3300060353 Bacteria 916
204 Ga0530510_0009624 3300061734 Bacteria 6778
205 Ga0530510_0129881 3300061734 Bacteria 1853
206 Ga0530510_0240033 3300061734 Bacteria 1349
207 Ga0070658_10183366
208 MBSR1b_contig_7594409
209 JGI25406J46586_10000181
210 Ga0065712_10391154
211 Ga0070676_10605879
212 Ga0070690_100000549
213 Ga0068869_100082785
214 Ga0068869_100637741
215 Ga0070666_10022385
216 Ga0070666_10561212
217 Ga0070689_100177194
218 Ga0070669_100010552
219 Ga0070675_100001050
220 Ga0070675_100056746
221 Ga0070675_100647795
222 Ga0070671_100551187
223 Ga0070671_100921178
224 Ga0070674_100418107
225 Ga0070673_100237503
226 Ga0070688_100265579
227 Ga0070714_100097510
228 Ga0070705_100691516
229 Ga0070700_100595962
230 Ga0068867_100481608
231 Ga0070706_100642999
232 Ga0070706_100997691
233 Ga0070698_100000383
234 Ga0070699_100031006
235 Ga0070672_100263885
236 Ga0070672_100669436
237 Ga0070686_100008481
238 Ga0070686_100082439
239 Ga0070696_100719109
240 Ga0070665_100252817
241 Ga0068855_100094327
242 Ga0068855_100321874
243 Ga0068855_101446391
244 Ga0068854_100024237
245 Ga0068854_100112157
246 Ga0070702_100184676
247 Ga0068852_100406027
248 Ga0068859_100911024
249 Ga0068860_100065123
250 Ga0081455_10133732
251 Ga0081539_10001078
252 Ga0075428_100000331
253 Ga0075428_101522911
254 Ga0075431_100029087
255 Ga0075433_10286669
256 Ga0075434_100309889
257 Ga0075434_100458095
258 Ga0075434_100532879
259 Ga0097620_100392259
260 Ga0097620_100910975
261 Ga0075435_100274833
262 Ga0105240_10142406
263 Ga0111539_10001187
264 Ga0111539_10343525
265 Ga0111539_11311915
266 Ga0105245_10050126
267 Ga0114129_10304008
268 Ga0114129_10927292
269 Ga0105241_10056346
270 Ga0105241_10208905
271 Ga0105241_11101731
272 Ga0105248_10267116
273 Ga0105248_10635623
274 Ga0105238_10755817
275 Ga0163162_10008795
276 Ga0163162_10520345
277 Ga0163163_10691946
278 Ga0157380_10009433
279 Ga0157380_10319949
280 Ga0157380_10656302
281 Ga0207680_10013693
282 Ga0207680_10350748
283 Ga0207645_10215050
284 Ga0207684_10505309
285 Ga0207654_10606039
286 Ga0207654_10975050
287 Ga0207695_10229806
288 Ga0207681_10003838
289 Ga0207681_10489398
290 Ga0207659_10002879
291 Ga0207659_10029023
292 Ga0207687_10151875
293 Ga0207664_10235905
294 Ga0207644_10609329
295 Ga0207706_10038697
296 Ga0207686_10133732
297 Ga0207670_10521548
298 Ga0207669_10378295
299 Ga0207691_10299726
300 Ga0207691_10316177
301 Ga0207691_10815466
302 Ga0207711_10318284
303 Ga0207711_10454254
304 Ga0207711_10660100
305 Ga0207689_10103131
306 Ga0207689_10270288
307 Ga0207667_10105043
308 Ga0207651_10099955
309 Ga0207651_10179852
310 Ga0207640_10077939
311 Ga0207648_10306042
312 Ga0207648_10348470
313 Ga0207698_10368526
314 Ga0207698_10520544
315 Ga0207428_10012766
316 Ga0268265_10533655
317 Ga0268264_10006539
318 Ga0268264_10289013
319 Ga0265337_1116764
320 Ga0265316_10976714
321 Ga0307408_100403592
322 Ga0307405_10946047
323 Ga0307409_100172198
324 Ga0307414_10651240
325 Ga0307411_11764627
326 Ga0307415_100378837
327 Ga0373923_0314662
328 Ga0373937_1045911
329 Ga0436365_0115852
330 Ga0436365_0473069
331 Ga0439453_0005029
332 Ga0466972_0081099
333 Ga0466963_0193057
334 Ga0495592_0204374
335 Ga0495650_0157143
336 Ga0495586_0324487
337 Ga0495645_0048980
338 Ga0495669_0481941
339 Ga0495684_0317219
340 Ga0495686_0160115
341 Ga0496100_0459334
342 Ga0496101_0168810
343 Ga0496103_0267758
344 Ga0496106_0092911
345 Ga0496107_0231409
346 Ga0496109_1301427
347 Ga0496110_0107862
348 Ga0501033_0540881
349 Ga0501036_0015042
350 Ga0501038_0189126
351 Ga0501038_0447792
352 Ga0501038_0712334
353 Ga0501039_0399625
354 Ga0501040_0007348
355 Ga0501040_0460630
356 Ga0501041_0000746
357 Ga0501041_0032647
358 Ga0501042_0072737
359 Ga0501042_0123503
360 Ga0501042_0207787
361 Ga0501042_0287244
362 Ga0501046_0021736
363 Ga0501046_0085952
364 Ga0501046_0781123
365 Ga0501071_0011401
366 Ga0501072_0002156
367 Ga0501072_0003203
368 Ga0501072_0043786
369 Ga0501072_0053892
370 Ga0501072_0117365
371 Ga0501073_0383649
372 Ga0501074_0251030
373 Ga0501075_0000583
374 Ga0501075_0018295
375 Ga0501075_0020923
376 Ga0501075_0059299
377 Ga0501075_0067025
378 Ga0501076_0063093
379 Ga0501076_0103172
380 Ga0501076_1373284
381 Ga0501077_0055674
382 Ga0501077_0105021
383 Ga0501077_0634321
384 Ga0501079_0408759
385 Ga0501079_0923244
386 Ga0501080_0005635
387 Ga0501080_0037603
388 Ga0501081_0003882
389 Ga0501081_0037193
390 Ga0501081_0162067
391 Ga0501083_0041732
392 Ga0501035_0134693
393 Ga0501045_0004432
394 Ga0501045_0453282
395 nmdc:mga09592_209273_c1
396 nmdc:mga08y16_10042_c1
397 nmdc:mga08y16_483015_c1
398 nmdc:mga0n895_1262465_c1
399 nmdc:mga0n895_132146_c1
400 nmdc:mga0rr50_97563_c1
401 Ga0501084_0010175
402 Ga0501084_0418093
403 Ga0590075_002044
404 Ga0590077_000513
405 Ga0501082_0005736
406 Ga0501082_0013125
407 Ga0501082_0131767
408 Ga0501082_0507739
409 Ga0501082_0658466
410 Ga0530510_0009624
411 Ga0530510_0129881
412 Ga0530510_0240033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

37

161

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

46

158

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.9424 1 167
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.9057 1 167
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.864 1 166
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8638 4 125
3n7z-assembly1.cif.gz_D crystal structure of acetyltransferase from bacillus anthracis 0.8554 5 126
ID Description Score Start End Superfamily
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.945 5 167 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9437 2 166 3.40.630.30
af_P39368_4_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9368 3 161 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8963 2 166 3.40.630.30
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8871 5 167 3.40.630.30
ID Description Score Start End GO Terms
AF-X0YCS5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9805 5 167 GO:0016747
AF-A0A6L4AYR1-F1-model_v4 N-acetyltransferase 0.977 5 168 GO:0016747
AF-A0A848V928-F1-model_v4 N-acetyltransferase 0.9768 7 168 GO:0016747
AF-A0A317HI50-F1-model_v4 GNAT family N-acetyltransferase 0.9761 5 168 GO:0016747
AF-X0UZS1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9753 75 168

Map