F314429

General Info

Members Datasets Scaffolds Average Seq Length
205 145 410 250

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_109034_c1|nmdc:mga0qj67_109034_c1_927_1718
Length 263
Sequence MILDRFGLAGKVAIVTGAGRGIAIGLAEAGADVALAARTASDLDEVAGLVEATGRRALAVPTDVTDSDALGALVDRTLETFGRLDVLVNNAGGTMPRPAMATSEGFLERAFRFNVTAAFNLTKLAARRMVDTSGGGAVVNISSRSASMTQTSFVAYGAAKAALDRLTRNIAPELAPRVRVNAIDVGGVATRSLDVVLTDDELRRQFLAGTPMGRPGEPEDIACAVLYLVSDASSWVTGKVFEIDGGTENPAIVVPVPPLEPTP

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.15
Nodule 0
Rhizoplane 4.88
Rhizosphere 79.51
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_109034_c1 3300050509 Bacteria 2234
2 Ga0070676_10425541 3300005328 Bacteria 929
3 Ga0070670_100500406 3300005331 Bacteria 1081
4 Ga0070675_100067105 3300005354 Bacteria 2968
5 Ga0070673_100467233 3300005364 Bacteria 1137
6 Ga0070705_100061582 3300005440 Bacteria 2231
7 Ga0070700_100128232 3300005441 Bacteria 1708
8 Ga0070708_100222053 3300005445 Bacteria 1772
9 Ga0070678_100213382 3300005456 Bacteria 1601
10 Ga0070672_100359715 3300005543 Bacteria 1242
11 Ga0070696_100061389 3300005546 Bacteria 2630
12 Ga0070665_100072179 3300005548 Bacteria 3460
13 Ga0070665_100198342 3300005548 Bacteria 2008
14 Ga0068863_100068578 3300005841 Bacteria 3355
15 Ga0068863_100213793 3300005841 Bacteria 1857
16 Ga0068858_100143766 3300005842 Bacteria 2240
17 Ga0068860_100000410 3300005843 Bacteria 55852
18 Ga0068860_100233394 3300005843 Bacteria 1788
19 Ga0081455_10018643 3300005937 Bacteria 6596
20 Ga0075365_10069395 3300006038 Bacteria 2369
21 Ga0075368_10000466 3300006042 Bacteria 12003
22 Ga0075363_100000961 3300006048 Bacteria 10234
23 Ga0075363_100019266 3300006048 Bacteria 3410
24 Ga0075363_100072610 3300006048 Bacteria 1871
25 Ga0075363_100118239 3300006048 Bacteria 1478
26 Ga0075364_10028115 3300006051 Bacteria 3598
27 Ga0075364_10033921 3300006051 Bacteria 3289
28 Ga0075364_10055267 3300006051 Bacteria 2597
29 Ga0075364_10125364 3300006051 Bacteria 1721
30 Ga0075367_10002023 3300006178 Bacteria 9062
31 Ga0075370_10007144 3300006353 Bacteria 5670
32 Ga0075370_10268775 3300006353 Bacteria 1012
33 Ga0075428_100010008 3300006844 Bacteria 10533
34 Ga0075428_100045176 3300006844 Bacteria 4840
35 Ga0075431_100093409 3300006847 Bacteria 3104
36 Ga0075431_100252804 3300006847 Bacteria 1790
37 Ga0075431_100377570 3300006847 Bacteria 1422
38 Ga0111539_10129393 3300009094 Bacteria 2956
39 Ga0111539_10866468 3300009094 Bacteria 1051
40 Ga0111539_11120222 3300009094 Bacteria 914
41 Ga0105245_10003277 3300009098 Bacteria 14527
42 Ga0114129_10152183 3300009147 Bacteria 3165
43 Ga0105243_10283514 3300009148 Bacteria 1493
44 Ga0105249_10131549 3300009553 Bacteria 2389
45 Ga0105249_10701836 3300009553 Bacteria 1072
46 Ga0105246_10142196 3300011119 Bacteria 1806
47 Ga0163162_10153955 3300013306 Bacteria 2418
48 Ga0157375_10425944 3300013308 Bacteria 1493
49 Ga0157375_10599534 3300013308 Bacteria 1261
50 Ga0163163_10313722 3300014325 Bacteria 1621
51 Ga0157379_10174964 3300014968 Bacteria 1938
52 Ga0157376_10155392 3300014969 Bacteria 2068
53 Ga0213876_10008617 3300021384 Bacteria 5518
54 Ga0207646_10266796 3300025922 Bacteria 1547
55 Ga0207681_10227554 3300025923 Bacteria 1446
56 Ga0207659_10202925 3300025926 Bacteria 1585
57 Ga0207687_10261041 3300025927 Bacteria 1381
58 Ga0207706_10141866 3300025933 Bacteria 2114
59 Ga0207670_10134221 3300025936 Bacteria 1818
60 Ga0207669_10508022 3300025937 Bacteria 966
61 Ga0207651_10387509 3300025960 Bacteria 1186
62 Ga0207712_10146455 3300025961 Bacteria 1819
63 Ga0207703_10920799 3300026035 Bacteria 837
64 Ga0207708_10326917 3300026075 Bacteria 1253
65 Ga0207641_10096309 3300026088 Bacteria 2599
66 Ga0207641_10147280 3300026088 Bacteria 2130
67 Ga0207675_100147462 3300026118 Bacteria 2238
68 Ga0207683_10052887 3300026121 Bacteria 3559
69 Ga0207683_10171051 3300026121 Bacteria 1968
70 Ga0207683_10270574 3300026121 Bacteria 1552
71 Ga0209813_10000582 3300027866 Bacteria 8528
72 Ga0207428_10290909 3300027907 Bacteria 1211
73 Ga0268266_10224685 3300028379 Bacteria 1727
74 Ga0268264_10000155 3300028381 Bacteria 156029
75 Ga0268264_10211657 3300028381 Bacteria 1780
76 Ga0268264_10729089 3300028381 Bacteria 986
77 Ga0268264_10734038 3300028381 Bacteria 983
78 Ga0268264_10946165 3300028381 Bacteria 866
79 Ga0265338_10000645 3300028800 Bacteria 60348
80 Ga0265765_1011424 3300030879 Bacteria 997
81 Ga0265332_10002461 3300031238 Bacteria 9428
82 Ga0265328_10102655 3300031239 Bacteria 1060
83 Ga0265328_10116417 3300031239 Bacteria 995
84 Ga0265325_10008936 3300031241 Bacteria 5884
85 Ga0265339_10000098 3300031249 Bacteria 73022
86 Ga0265339_10001304 3300031249 Bacteria 18675
87 Ga0265331_10026142 3300031250 Bacteria 2938
88 Ga0265327_10000119 3300031251 Bacteria 171254
89 Ga0265327_10062442 3300031251 Bacteria 1896
90 Ga0265316_10076276 3300031344 Bacteria 2576
91 Ga0265313_10062029 3300031595 Bacteria 1747
92 Ga0265314_10000998 3300031711 Bacteria 33204
93 Ga0265314_10194541 3300031711 Bacteria 1204
94 Ga0265342_10113125 3300031712 Bacteria 1534
95 Ga0307413_10004462 3300031824 Bacteria 6095
96 Ga0307410_10001010 3300031852 Bacteria 12189
97 Ga0307409_100187150 3300031995 Bacteria 1839
98 Ga0307416_100213259 3300032002 Bacteria 1844
99 Ga0307414_10006078 3300032004 Bacteria 6698
100 Ga0307411_10001679 3300032005 Bacteria 9268
101 Ga0373944_0013352 3300035089 Bacteria 2277
102 Ga0316574_0203959 3300035398 Bacteria 1270
103 Ga0373935_0132697 3300035692 Bacteria 1675
104 Ga0373927_0011554 3300035695 Bacteria 5883
105 Ga0373947_0145865 3300035725 Bacteria 1521
106 Ga0373947_0249660 3300035725 Bacteria 1173
107 Ga0373937_0037894 3300036401 Bacteria 4394
108 Ga0373937_0255356 3300036401 Bacteria 1652
109 Ga0436365_0832399 3300039437 Bacteria 5947
110 Ga0436365_1776775 3300039437 Bacteria 3852
111 Ga0436360_0490963 3300039438 Unclassified 1675
112 Ga0466967_0637852 3300045976 Bacteria 1053
113 Ga0495629_0190724 3300046459 Bacteria 1419
114 Ga0495653_0115389 3300046463 Bacteria 1922
115 Ga0495653_0123535 3300046463 Bacteria 1841
116 Ga0495580_0030310 3300046472 Bacteria 3918
117 Ga0495580_0076718 3300046472 Bacteria 2331
118 Ga0495639_0034358 3300046475 Bacteria 2268
119 Ga0495608_0018593 3300046511 Bacteria 4790
120 Ga0495608_0031962 3300046511 Bacteria 3557
121 Ga0495618_0053344 3300046514 Bacteria 2557
122 Ga0495630_0041029 3300046517 Bacteria 3457
123 Ga0495630_0068609 3300046517 Bacteria 2667
124 Ga0495630_0137613 3300046517 Bacteria 1856
125 Ga0495652_0044747 3300046529 Bacteria 3811
126 Ga0495640_0070215 3300046533 Bacteria 2354
127 Ga0495621_0023920 3300046539 Bacteria 2035
128 Ga0495667_0008135 3300046559 Bacteria 7116
129 Ga0495634_0271746 3300046642 Bacteria 1031
130 Ga0495635_0111354 3300046663 Bacteria 1870
131 Ga0495635_0271816 3300046663 Bacteria 1140
132 Ga0495657_0091451 3300046675 Bacteria 1951
133 Ga0495623_0009949 3300046679 Bacteria 6161
134 Ga0495647_0034246 3300046681 Bacteria 1902
135 Ga0495658_0051061 3300046683 Bacteria 2342
136 Ga0495613_0000483 3300046689 Bacteria 33903
137 Ga0495604_0045281 3300047317 Bacteria 3434
138 Ga0495604_0321837 3300047317 Bacteria 1033
139 Ga0495676_0017132 3300047321 Bacteria 6412
140 Ga0495676_0096626 3300047321 Bacteria 2196
141 Ga0495680_0047653 3300047322 Bacteria 3369
142 Ga0495680_0249879 3300047322 Bacteria 1257
143 Ga0495684_0076847 3300047471 Bacteria 2536
144 Ga0495602_0043031 3300048088 Bacteria 4110
145 Ga0495614_0104227 3300048089 Bacteria 1242
146 Ga0496104_0686821 3300048907 Bacteria 932
147 Ga0496108_0126631 3300048911 Bacteria 2193
148 Ga0496108_0675152 3300048911 Bacteria 897
149 Ga0496109_0001172 3300048912 Bacteria 21798
150 Ga0496112_0004688 3300048915 Bacteria 11636
151 Ga0496112_0008503 3300048915 Bacteria 9197
152 Ga0496112_0239733 3300048915 Bacteria 1766
153 Ga0496113_0251477 3300048916 Bacteria 1411
154 Ga0496114_0060780 3300048917 Bacteria 3159
155 Ga0496115_0257642 3300048918 Bacteria 1435
156 Ga0501033_0012569 3300049570 Bacteria 6460
157 Ga0501034_0489759 3300049571 Bacteria 1144
158 Ga0501036_0084663 3300049572 Bacteria 2680
159 Ga0501037_0002718 3300049573 Bacteria 12787
160 Ga0501037_0070685 3300049573 Bacteria 2539
161 Ga0501038_0068196 3300049574 Bacteria 3024
162 Ga0501038_0073408 3300049574 Bacteria 2898
163 Ga0501039_0014719 3300049575 Bacteria 5984
164 Ga0501039_0129072 3300049575 Bacteria 1984
165 Ga0501042_0038047 3300049578 Bacteria 3416
166 Ga0501042_0204776 3300049578 Bacteria 1423
167 Ga0501043_0025775 3300049579 Bacteria 4612
168 Ga0501043_0065840 3300049579 Bacteria 2845
169 Ga0501046_0010203 3300049580 Bacteria 8083
170 Ga0501048_0011622 3300049582 Bacteria 6566
171 Ga0501048_0061459 3300049582 Bacteria 2660
172 Ga0501069_0188257 3300049585 Bacteria 1194
173 Ga0501070_0009237 3300049586 Bacteria 8337
174 Ga0501070_0011136 3300049586 Bacteria 7591
175 Ga0501072_0159769 3300049588 Bacteria 1798
176 Ga0501074_0084832 3300049590 Bacteria 2270
177 Ga0501075_0194725 3300049591 Bacteria 1546
178 Ga0501080_0543458 3300049742 Bacteria 1035
179 Ga0501044_0016819 3300049823 Bacteria 7848
180 nmdc:mga03n38_59497_c1 3300050490 Bacteria 1734
181 nmdc:mga03n38_73996_c1 3300050490 Bacteria 1583
182 nmdc:mga03n38_87414_c1 3300050490 Bacteria 1477
183 nmdc:mga00v17_83769_c1 3300050491 Bacteria 1995
184 nmdc:mga00v17_87073_c1 3300050491 Bacteria 1958
185 nmdc:mga0yw44_144759_c1 3300050492 Bacteria 1547
186 nmdc:mga0yw44_193200_c1 3300050492 Bacteria 1343
187 nmdc:mga0yw44_328016_c1 3300050492 Bacteria 1028
188 nmdc:mga0yw44_55269_c1 3300050492 Bacteria 2415
189 nmdc:mga06z11_15341_c1 3300050494 Bacteria 3418
190 nmdc:mga04h51_4321_c1 3300050495 Bacteria 3525
191 nmdc:mga07m45_71385_c1 3300050496 Bacteria 1976
192 nmdc:mga08y16_10988_c1 3300050511 Bacteria 9505
193 nmdc:mga08y16_227474_c1 3300050511 Bacteria 1930
194 nmdc:mga08y16_657951_c1 3300050511 Bacteria 1051
195 nmdc:mga0a205_560363_c1 3300050515 Bacteria 997
196 Ga0495601_0405240 3300053077 Bacteria 884
197 Ga0495595_0001585 3300053084 Bacteria 8879
198 Ga0495619_0025271 3300053085 Bacteria 3813
199 Ga0495619_0068338 3300053085 Bacteria 2373
200 Ga0495619_0071006 3300053085 Bacteria 2329
201 Ga0500566_0140968 3300053094 Bacteria 1279
202 Ga0500568_0000045 3300053139 Bacteria 125714
203 Ga0500616_0000918 3300053153 Bacteria 32197
204 Ga0501084_0000039 3300054114 Bacteria 107409
205 Ga0530510_0140548 3300061734 Bacteria 1779
206 nmdc:mga0qj67_109034_c1
207 Ga0070676_10425541
208 Ga0070670_100500406
209 Ga0070675_100067105
210 Ga0070673_100467233
211 Ga0070705_100061582
212 Ga0070700_100128232
213 Ga0070708_100222053
214 Ga0070678_100213382
215 Ga0070672_100359715
216 Ga0070696_100061389
217 Ga0070665_100072179
218 Ga0070665_100198342
219 Ga0068863_100068578
220 Ga0068863_100213793
221 Ga0068858_100143766
222 Ga0068860_100000410
223 Ga0068860_100233394
224 Ga0081455_10018643
225 Ga0075365_10069395
226 Ga0075368_10000466
227 Ga0075363_100000961
228 Ga0075363_100019266
229 Ga0075363_100072610
230 Ga0075363_100118239
231 Ga0075364_10028115
232 Ga0075364_10033921
233 Ga0075364_10055267
234 Ga0075364_10125364
235 Ga0075367_10002023
236 Ga0075370_10007144
237 Ga0075370_10268775
238 Ga0075428_100010008
239 Ga0075428_100045176
240 Ga0075431_100093409
241 Ga0075431_100252804
242 Ga0075431_100377570
243 Ga0111539_10129393
244 Ga0111539_10866468
245 Ga0111539_11120222
246 Ga0105245_10003277
247 Ga0114129_10152183
248 Ga0105243_10283514
249 Ga0105249_10131549
250 Ga0105249_10701836
251 Ga0105246_10142196
252 Ga0163162_10153955
253 Ga0157375_10425944
254 Ga0157375_10599534
255 Ga0163163_10313722
256 Ga0157379_10174964
257 Ga0157376_10155392
258 Ga0213876_10008617
259 Ga0207646_10266796
260 Ga0207681_10227554
261 Ga0207659_10202925
262 Ga0207687_10261041
263 Ga0207706_10141866
264 Ga0207670_10134221
265 Ga0207669_10508022
266 Ga0207651_10387509
267 Ga0207712_10146455
268 Ga0207703_10920799
269 Ga0207708_10326917
270 Ga0207641_10096309
271 Ga0207641_10147280
272 Ga0207675_100147462
273 Ga0207683_10052887
274 Ga0207683_10171051
275 Ga0207683_10270574
276 Ga0209813_10000582
277 Ga0207428_10290909
278 Ga0268266_10224685
279 Ga0268264_10000155
280 Ga0268264_10211657
281 Ga0268264_10729089
282 Ga0268264_10734038
283 Ga0268264_10946165
284 Ga0265338_10000645
285 Ga0265765_1011424
286 Ga0265332_10002461
287 Ga0265328_10102655
288 Ga0265328_10116417
289 Ga0265325_10008936
290 Ga0265339_10000098
291 Ga0265339_10001304
292 Ga0265331_10026142
293 Ga0265327_10000119
294 Ga0265327_10062442
295 Ga0265316_10076276
296 Ga0265313_10062029
297 Ga0265314_10000998
298 Ga0265314_10194541
299 Ga0265342_10113125
300 Ga0307413_10004462
301 Ga0307410_10001010
302 Ga0307409_100187150
303 Ga0307416_100213259
304 Ga0307414_10006078
305 Ga0307411_10001679
306 Ga0373944_0013352
307 Ga0316574_0203959
308 Ga0373935_0132697
309 Ga0373927_0011554
310 Ga0373947_0145865
311 Ga0373947_0249660
312 Ga0373937_0037894
313 Ga0373937_0255356
314 Ga0436365_0832399
315 Ga0436365_1776775
316 Ga0436360_0490963
317 Ga0466967_0637852
318 Ga0495629_0190724
319 Ga0495653_0115389
320 Ga0495653_0123535
321 Ga0495580_0030310
322 Ga0495580_0076718
323 Ga0495639_0034358
324 Ga0495608_0018593
325 Ga0495608_0031962
326 Ga0495618_0053344
327 Ga0495630_0041029
328 Ga0495630_0068609
329 Ga0495630_0137613
330 Ga0495652_0044747
331 Ga0495640_0070215
332 Ga0495621_0023920
333 Ga0495667_0008135
334 Ga0495634_0271746
335 Ga0495635_0111354
336 Ga0495635_0271816
337 Ga0495657_0091451
338 Ga0495623_0009949
339 Ga0495647_0034246
340 Ga0495658_0051061
341 Ga0495613_0000483
342 Ga0495604_0045281
343 Ga0495604_0321837
344 Ga0495676_0017132
345 Ga0495676_0096626
346 Ga0495680_0047653
347 Ga0495680_0249879
348 Ga0495684_0076847
349 Ga0495602_0043031
350 Ga0495614_0104227
351 Ga0496104_0686821
352 Ga0496108_0126631
353 Ga0496108_0675152
354 Ga0496109_0001172
355 Ga0496112_0004688
356 Ga0496112_0008503
357 Ga0496112_0239733
358 Ga0496113_0251477
359 Ga0496114_0060780
360 Ga0496115_0257642
361 Ga0501033_0012569
362 Ga0501034_0489759
363 Ga0501036_0084663
364 Ga0501037_0002718
365 Ga0501037_0070685
366 Ga0501038_0068196
367 Ga0501038_0073408
368 Ga0501039_0014719
369 Ga0501039_0129072
370 Ga0501042_0038047
371 Ga0501042_0204776
372 Ga0501043_0025775
373 Ga0501043_0065840
374 Ga0501046_0010203
375 Ga0501048_0011622
376 Ga0501048_0061459
377 Ga0501069_0188257
378 Ga0501070_0009237
379 Ga0501070_0011136
380 Ga0501072_0159769
381 Ga0501074_0084832
382 Ga0501075_0194725
383 Ga0501080_0543458
384 Ga0501044_0016819
385 nmdc:mga03n38_59497_c1
386 nmdc:mga03n38_73996_c1
387 nmdc:mga03n38_87414_c1
388 nmdc:mga00v17_83769_c1
389 nmdc:mga00v17_87073_c1
390 nmdc:mga0yw44_144759_c1
391 nmdc:mga0yw44_193200_c1
392 nmdc:mga0yw44_328016_c1
393 nmdc:mga0yw44_55269_c1
394 nmdc:mga06z11_15341_c1
395 nmdc:mga04h51_4321_c1
396 nmdc:mga07m45_71385_c1
397 nmdc:mga08y16_10988_c1
398 nmdc:mga08y16_227474_c1
399 nmdc:mga08y16_657951_c1
400 nmdc:mga0a205_560363_c1
401 Ga0495601_0405240
402 Ga0495595_0001585
403 Ga0495619_0025271
404 Ga0495619_0068338
405 Ga0495619_0071006
406 Ga0500566_0140968
407 Ga0500568_0000045
408 Ga0500616_0000918
409 Ga0501084_0000039
410 Ga0530510_0140548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

201

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

248

0.96

PF08659

KR

KR domain

12

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gaf-assembly1.cif.gz_A 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.9411 6 232
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9369 12 231
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9342 11 231
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.9334 11 231
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9323 11 231
ID Description Score Start End Superfamily
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 1 236 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9295 11 231 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.929 11 231 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 68 231 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9267 4 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A354B824-F1-model_v4 Short chain dehydrogenase 0.9529 48 234 GO:0016616
AF-A0A3M7DHN4-F1-model_v4 Uncharacterized protein 0.9529 43 231 GO:0006633
GO:0016616
GO:0048038
AF-A0A1B1ZKV7-F1-model_v4 Oxidoreductase 0.9525 11 231 GO:0016616
AF-A0A2N2KKP5-F1-model_v4 Short-chain dehydrogenase 0.9518 4 231 GO:0016491
AF-A0A426QZN1-F1-model_v4 SDR family oxidoreductase 0.9518 48 237 GO:0016491

Map