F314204

General Info

Members Datasets Scaffolds Average Seq Length
205 151 410 479

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0041256|Ga0453683_0041256_73_1692
Length 539
Sequence MTAALFEEIVQPDGRHELKPEVDAALGDSPLHNADLAPVPVAKRTWTTYNYVALWIGMAHNIPTWGLAAGLVAIGMAWYQAIFTIMLANVIVLVPMLLNSHAGTKYGIPFPVFARASFGVYGANLAALIRAGIACGWFGIQTWIGGGALYTVMGAIFGKDSWWLTASKFQIGFGDPQPWTLWLSFAVFWAANIFIILNGMDFIRRFENWAAPFVLIVAFFLLAWMTIQAGGFGPLVEDHGTLGWGSNFWLVFWPSLMGMIAFWSTLSLNMPDFTRFGKSQRTQAIGQALGLPTTMTVFPLIAVLVTSATKTVYGDYIWDPVALVGRFGDGSIGGVVVVVLALFTLAIATLSVNVAANIVSPSYDFSNAWPKRISFRTGGLITGILGILIQPWMLLSSPEVYIFTWLGFYGGATGAIAGVLIADYWLIRRTDLRLADLYRTTGVYRYTSGWNWRAVVSLALGAFIALGGAYSVTGADGKATGPFPPGGIVGFLHVQLPWGGYLYDYSWILGLVVSFVAYWAFTKFVPQRESVAEAAAQPV

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
151 2867475112 Streptomyces sp. TM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.49
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 1.95
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0041256 3300044673 Bacteria 2897
2 JGI25150J39212_1000316 3300002774 Bacteria 23873
3 Ga0070658_10001619 3300005327 Bacteria 19029
4 Ga0070690_100060730 3300005330 Bacteria 2433
5 Ga0070666_10010273 3300005335 Bacteria 5851
6 Ga0070666_10012005 3300005335 Bacteria 5452
7 Ga0070671_100022724 3300005355 Bacteria 5124
8 Ga0070673_100011521 3300005364 Bacteria 6038
9 Ga0070673_100033816 3300005364 Unclassified 3863
10 Ga0070688_100164088 3300005365 Bacteria 1528
11 Ga0070659_100029549 3300005366 Unclassified 4236
12 Ga0070667_100176852 3300005367 Bacteria 1886
13 Ga0070713_100042868 3300005436 Bacteria 3696
14 Ga0070705_100051700 3300005440 Bacteria 2398
15 Ga0070694_100023130 3300005444 Bacteria 3993
16 Ga0070708_100047682 3300005445 Bacteria 3785
17 Ga0070708_100095442 3300005445 Bacteria 2715
18 Ga0070681_10010571 3300005458 Bacteria 9117
19 Ga0070706_100015259 3300005467 Bacteria 7092
20 Ga0070706_100051764 3300005467 Bacteria 3791
21 Ga0070706_100082793 3300005467 Bacteria 2972
22 Ga0070707_100000208 3300005468 Bacteria 58895
23 Ga0070707_100004565 3300005468 Bacteria 12963
24 Ga0070707_100053372 3300005468 Bacteria 3875
25 Ga0070698_100000837 3300005471 Bacteria 33661
26 Ga0070698_100020554 3300005471 Bacteria 6922
27 Ga0070698_100061402 3300005471 Bacteria 3792
28 Ga0070699_100043770 3300005518 Bacteria 3875
29 Ga0070679_100112230 3300005530 Unclassified 2712
30 Ga0070697_100002771 3300005536 Bacteria 13494
31 Ga0070697_100009695 3300005536 Bacteria 7518
32 Ga0070697_100054380 3300005536 Bacteria 3254
33 Ga0070686_100031924 3300005544 Bacteria 3225
34 Ga0070696_100004738 3300005546 Bacteria 9093
35 Ga0070693_100000105 3300005547 Bacteria 37510
36 Ga0070665_100006263 3300005548 Bacteria 12164
37 Ga0068859_100023999 3300005617 Bacteria 6120
38 Ga0068864_100008231 3300005618 Bacteria 8601
39 Ga0068863_100015188 3300005841 Bacteria 7398
40 Ga0068858_100041478 3300005842 Bacteria 4266
41 Ga0068860_100116354 3300005843 Bacteria 2558
42 Ga0081540_1053973 3300005983 Bacteria 1967
43 Ga0075368_10012830 3300006042 Bacteria 3070
44 Ga0070716_100000676 3300006173 Bacteria 14574
45 Ga0075367_10018837 3300006178 Bacteria 3815
46 Ga0075428_100091220 3300006844 Unclassified 3323
47 Ga0075430_100113091 3300006846 Unclassified 2263
48 Ga0075431_100006185 3300006847 Bacteria 11882
49 Ga0075434_100023366 3300006871 Bacteria 6023
50 Ga0075436_100001010 3300006914 Bacteria 18936
51 Ga0075436_100004722 3300006914 Bacteria 9347
52 Ga0075435_100073210 3300007076 Bacteria 2800
53 Ga0099794_10003817 3300007265 Bacteria 5819
54 Ga0099794_10005698 3300007265 Bacteria 5017
55 Ga0099794_10010777 3300007265 Bacteria 3891
56 Ga0099794_10035614 3300007265 Bacteria 2350
57 Ga0099794_10063212 3300007265 Bacteria 1801
58 Ga0105240_10091200 3300009093 Bacteria 3723
59 Ga0105240_10425104 3300009093 Unclassified 1492
60 Ga0105247_10000852 3300009101 Bacteria 23105
61 Ga0114129_10000558 3300009147 Bacteria 45754
62 Ga0114129_10190385 3300009147 Bacteria 2786
63 Ga0114129_10199549 3300009147 Unclassified 2711
64 Ga0105242_10186560 3300009176 Bacteria 1833
65 Ga0105248_10016191 3300009177 Bacteria 8206
66 Ga0105248_10028882 3300009177 Bacteria 6183
67 Ga0157374_10023280 3300013296 Bacteria 5538
68 Ga0157378_10000103 3300013297 Bacteria 80099
69 Ga0163162_10000015 3300013306 Bacteria 261996
70 Ga0163162_10003571 3300013306 Bacteria 14873
71 Ga0163162_10004627 3300013306 Bacteria 13262
72 Ga0163162_10026236 3300013306 Bacteria 5759
73 Ga0163163_10015126 3300014325 Bacteria 7122
74 Ga0157379_10033067 3300014968 Bacteria 4611
75 Ga0157376_10023356 3300014969 Bacteria 4838
76 Ga0157376_10026267 3300014969 Bacteria 4599
77 Ga0213872_10003662 3300021361 Bacteria 8426
78 Ga0213872_10010466 3300021361 Bacteria 4414
79 Ga0213871_10001127 3300021441 Bacteria 4252
80 Ga0209025_1000827 3300025294 Bacteria 49278
81 Ga0207684_10001604 3300025910 Bacteria 24022
82 Ga0207684_10005081 3300025910 Bacteria 12264
83 Ga0207652_10194913 3300025921 Unclassified 1822
84 Ga0207646_10000015 3300025922 Bacteria 337243
85 Ga0207646_10000016 3300025922 Bacteria 337048
86 Ga0207646_10121462 3300025922 Bacteria 2347
87 Ga0207700_10142839 3300025928 Unclassified 1969
88 Ga0207644_10001334 3300025931 Bacteria 15841
89 Ga0207644_10119073 3300025931 Bacteria 2007
90 Ga0207690_10072776 3300025932 Unclassified 2374
91 Ga0207690_10077650 3300025932 Bacteria 2309
92 Ga0207665_10000020 3300025939 Bacteria 117316
93 Ga0207711_10013244 3300025941 Bacteria 6853
94 Ga0207651_10118562 3300025960 Bacteria 2002
95 Ga0207703_10041878 3300026035 Bacteria 3671
96 Ga0207641_10044092 3300026088 Unclassified 3749
97 Ga0207676_10040511 3300026095 Bacteria 3570
98 Ga0209588_1009101 3300027671 Bacteria 2960
99 Ga0209588_1015412 3300027671 Bacteria 2350
100 Ga0268266_10015853 3300028379 Bacteria 6449
101 Ga0268264_10047935 3300028381 Bacteria 3553
102 Ga0265338_10005394 3300028800 Bacteria 16705
103 Ga0265765_1000523 3300030879 Bacteria 3066
104 Ga0265320_10000798 3300031240 Bacteria 23919
105 Ga0265325_10000867 3300031241 Bacteria 21791
106 Ga0265329_10002422 3300031242 Bacteria 8457
107 Ga0265339_10030134 3300031249 Bacteria 3074
108 Ga0265331_10023868 3300031250 Bacteria 3100
109 Ga0265313_10023597 3300031595 Bacteria 3311
110 Ga0265314_10012287 3300031711 Bacteria 6997
111 Ga0316212_1002592 3300033547 Bacteria 2582
112 Ga0373946_0007482 3300035171 Bacteria 3992
113 Ga0373927_0000309 3300035695 Bacteria 38392
114 Ga0373947_0017271 3300035725 Bacteria 4150
115 Ga0373937_0033022 3300036401 Bacteria 4697
116 Ga0395900_0018700 3300037418 Bacteria 7066
117 Ga0436360_0373532 3300039438 Bacteria 3194
118 Ga0436360_0496319 3300039438 Bacteria 9336
119 Ga0436361_0353277 3300039447 Bacteria 16573
120 Ga0436361_0505405 3300039447 Bacteria 5309
121 Ga0436361_1069946 3300039447 Bacteria 18606
122 Ga0439444_0003013 3300042437 Bacteria 2349
123 Ga0451577_0011227 3300042876 Bacteria 8490
124 Ga0451577_0095438 3300042876 Bacteria 2656
125 Ga0453684_0051940 3300044712 Bacteria 5366
126 Ga0451576_0012723 3300045051 Bacteria 9446
127 Ga0495629_0011721 3300046459 Bacteria 6362
128 Ga0495629_0011945 3300046459 Bacteria 6298
129 Ga0495651_0033093 3300046462 Unclassified 4032
130 Ga0495653_0019686 3300046463 Bacteria 5474
131 Ga0495580_0002518 3300046472 Bacteria 15984
132 Ga0495580_0016050 3300046472 Bacteria 5630
133 Ga0495580_0031715 3300046472 Bacteria 3817
134 Ga0495582_0005156 3300046473 Bacteria 7312
135 Ga0495662_0002071 3300046476 Bacteria 10058
136 Ga0495664_0133556 3300046477 Bacteria 1503
137 Ga0495594_0000471 3300046499 Bacteria 20516
138 Ga0495594_0000513 3300046499 Bacteria 19765
139 Ga0495618_0040666 3300046514 Bacteria 2927
140 Ga0495618_0053523 3300046514 Bacteria 2552
141 Ga0495628_0012169 3300046516 Bacteria 7251
142 Ga0495630_0124272 3300046517 Bacteria 1958
143 Ga0495666_0068158 3300046526 Unclassified 1694
144 Ga0495652_0024509 3300046529 Bacteria 5340
145 Ga0495665_0001940 3300046531 Bacteria 11161
146 Ga0495665_0023592 3300046531 Bacteria 3304
147 Ga0495640_0006497 3300046533 Bacteria 9244
148 Ga0495586_0006950 3300046535 Bacteria 6027
149 Ga0495645_0020355 3300046543 Unclassified 4785
150 Ga0495645_0022433 3300046543 Unclassified 4568
151 Ga0495645_0056391 3300046543 Bacteria 2853
152 Ga0495667_0025686 3300046559 Unclassified 3968
153 Ga0495634_0009517 3300046642 Bacteria 7163
154 Ga0495635_0011667 3300046663 Bacteria 6158
155 Ga0495657_0089749 3300046675 Bacteria 1974
156 Ga0495599_0026907 3300046678 Unclassified 3605
157 Ga0495623_0005624 3300046679 Bacteria 8183
158 Ga0495646_0002183 3300046680 Bacteria 11919
159 Ga0495646_0029899 3300046680 Bacteria 3403
160 Ga0495613_0009607 3300046689 Bacteria 7185
161 Ga0495613_0014801 3300046689 Bacteria 5789
162 Ga0495624_0012730 3300046690 Bacteria 5745
163 Ga0495600_0003944 3300046809 Bacteria 8811
164 Ga0495581_0005617 3300047315 Bacteria 7269
165 Ga0495604_0003721 3300047317 Bacteria 12154
166 Ga0495604_0028589 3300047317 Bacteria 4436
167 Ga0495674_0090537 3300047319 Bacteria 2614
168 Ga0495674_0102964 3300047319 Unclassified 2427
169 Ga0495676_0008831 3300047321 Bacteria 9215
170 Ga0495680_0014142 3300047322 Bacteria 6932
171 Ga0495675_0006755 3300047444 Bacteria 7035
172 Ga0495684_0002721 3300047471 Bacteria 13986
173 Ga0495684_0090440 3300047471 Bacteria 2319
174 Ga0495614_0004299 3300048089 Bacteria 6418
175 Ga0495614_0006001 3300048089 Bacteria 5466
176 Ga0496102_0041503 3300048905 Bacteria 4166
177 Ga0496104_0095331 3300048907 Bacteria 2847
178 Ga0496112_0133326 3300048915 Bacteria 2455
179 Ga0496112_0168641 3300048915 Bacteria 2155
180 Ga0501033_0124743 3300049570 Bacteria 1867
181 Ga0501042_0009817 3300049578 Bacteria 6392
182 Ga0501043_0045292 3300049579 Bacteria 3460
183 Ga0501048_0028418 3300049582 Bacteria 4059
184 Ga0501072_0046527 3300049588 Bacteria 3415
185 Ga0501075_0020316 3300049591 Bacteria 4829
186 Ga0501077_0016970 3300049593 Bacteria 4592
187 Ga0501035_0014954 3300049822 Bacteria 7160
188 Ga0501044_0006131 3300049823 Bacteria 13273
189 Ga0501045_0069001 3300049824 Bacteria 2598
190 nmdc:mga05p37_1526_c1 3300050507 Bacteria 22128
191 nmdc:mga05p37_166891_c1 3300050507 Bacteria 2686
192 nmdc:mga0qj67_21091_c1 3300050509 Bacteria 4996
193 nmdc:mga06r32_5849_c1 3300050510 Bacteria 11068
194 nmdc:mga08y16_63710_c1 3300050511 Bacteria 3850
195 nmdc:mga0n895_97896_c1 3300050512 Bacteria 2940
196 nmdc:mga0rr50_14212_c1 3300050513 Bacteria 5214
197 nmdc:mga0rr50_152188_c1 3300050513 Bacteria 1870
198 nmdc:mga0rr50_41490_c1 3300050513 Bacteria 3354
199 nmdc:mga08x19_10200_c1 3300050514 Bacteria 5638
200 nmdc:mga08x19_37670_c1 3300050514 Bacteria 3070
201 nmdc:mga0a205_30002_c1 3300050515 Bacteria 2862
202 Ga0495612_0026705 3300053078 Unclassified 2320
203 Ga0500641_0003747 3300053096 Bacteria 5374
204 2808967868 2808606384 Bacteria 8474373
205 2867478934 2867475112 Bacteria 6909112
206 Ga0453683_0041256
207 JGI25150J39212_1000316
208 Ga0070658_10001619
209 Ga0070690_100060730
210 Ga0070666_10010273
211 Ga0070666_10012005
212 Ga0070671_100022724
213 Ga0070673_100011521
214 Ga0070673_100033816
215 Ga0070688_100164088
216 Ga0070659_100029549
217 Ga0070667_100176852
218 Ga0070713_100042868
219 Ga0070705_100051700
220 Ga0070694_100023130
221 Ga0070708_100047682
222 Ga0070708_100095442
223 Ga0070681_10010571
224 Ga0070706_100015259
225 Ga0070706_100051764
226 Ga0070706_100082793
227 Ga0070707_100000208
228 Ga0070707_100004565
229 Ga0070707_100053372
230 Ga0070698_100000837
231 Ga0070698_100020554
232 Ga0070698_100061402
233 Ga0070699_100043770
234 Ga0070679_100112230
235 Ga0070697_100002771
236 Ga0070697_100009695
237 Ga0070697_100054380
238 Ga0070686_100031924
239 Ga0070696_100004738
240 Ga0070693_100000105
241 Ga0070665_100006263
242 Ga0068859_100023999
243 Ga0068864_100008231
244 Ga0068863_100015188
245 Ga0068858_100041478
246 Ga0068860_100116354
247 Ga0081540_1053973
248 Ga0075368_10012830
249 Ga0070716_100000676
250 Ga0075367_10018837
251 Ga0075428_100091220
252 Ga0075430_100113091
253 Ga0075431_100006185
254 Ga0075434_100023366
255 Ga0075436_100001010
256 Ga0075436_100004722
257 Ga0075435_100073210
258 Ga0099794_10003817
259 Ga0099794_10005698
260 Ga0099794_10010777
261 Ga0099794_10035614
262 Ga0099794_10063212
263 Ga0105240_10091200
264 Ga0105240_10425104
265 Ga0105247_10000852
266 Ga0114129_10000558
267 Ga0114129_10190385
268 Ga0114129_10199549
269 Ga0105242_10186560
270 Ga0105248_10016191
271 Ga0105248_10028882
272 Ga0157374_10023280
273 Ga0157378_10000103
274 Ga0163162_10000015
275 Ga0163162_10003571
276 Ga0163162_10004627
277 Ga0163162_10026236
278 Ga0163163_10015126
279 Ga0157379_10033067
280 Ga0157376_10023356
281 Ga0157376_10026267
282 Ga0213872_10003662
283 Ga0213872_10010466
284 Ga0213871_10001127
285 Ga0209025_1000827
286 Ga0207684_10001604
287 Ga0207684_10005081
288 Ga0207652_10194913
289 Ga0207646_10000015
290 Ga0207646_10000016
291 Ga0207646_10121462
292 Ga0207700_10142839
293 Ga0207644_10001334
294 Ga0207644_10119073
295 Ga0207690_10072776
296 Ga0207690_10077650
297 Ga0207665_10000020
298 Ga0207711_10013244
299 Ga0207651_10118562
300 Ga0207703_10041878
301 Ga0207641_10044092
302 Ga0207676_10040511
303 Ga0209588_1009101
304 Ga0209588_1015412
305 Ga0268266_10015853
306 Ga0268264_10047935
307 Ga0265338_10005394
308 Ga0265765_1000523
309 Ga0265320_10000798
310 Ga0265325_10000867
311 Ga0265329_10002422
312 Ga0265339_10030134
313 Ga0265331_10023868
314 Ga0265313_10023597
315 Ga0265314_10012287
316 Ga0316212_1002592
317 Ga0373946_0007482
318 Ga0373927_0000309
319 Ga0373947_0017271
320 Ga0373937_0033022
321 Ga0395900_0018700
322 Ga0436360_0373532
323 Ga0436360_0496319
324 Ga0436361_0353277
325 Ga0436361_0505405
326 Ga0436361_1069946
327 Ga0439444_0003013
328 Ga0451577_0011227
329 Ga0451577_0095438
330 Ga0453684_0051940
331 Ga0451576_0012723
332 Ga0495629_0011721
333 Ga0495629_0011945
334 Ga0495651_0033093
335 Ga0495653_0019686
336 Ga0495580_0002518
337 Ga0495580_0016050
338 Ga0495580_0031715
339 Ga0495582_0005156
340 Ga0495662_0002071
341 Ga0495664_0133556
342 Ga0495594_0000471
343 Ga0495594_0000513
344 Ga0495618_0040666
345 Ga0495618_0053523
346 Ga0495628_0012169
347 Ga0495630_0124272
348 Ga0495666_0068158
349 Ga0495652_0024509
350 Ga0495665_0001940
351 Ga0495665_0023592
352 Ga0495640_0006497
353 Ga0495586_0006950
354 Ga0495645_0020355
355 Ga0495645_0022433
356 Ga0495645_0056391
357 Ga0495667_0025686
358 Ga0495634_0009517
359 Ga0495635_0011667
360 Ga0495657_0089749
361 Ga0495599_0026907
362 Ga0495623_0005624
363 Ga0495646_0002183
364 Ga0495646_0029899
365 Ga0495613_0009607
366 Ga0495613_0014801
367 Ga0495624_0012730
368 Ga0495600_0003944
369 Ga0495581_0005617
370 Ga0495604_0003721
371 Ga0495604_0028589
372 Ga0495674_0090537
373 Ga0495674_0102964
374 Ga0495676_0008831
375 Ga0495680_0014142
376 Ga0495675_0006755
377 Ga0495684_0002721
378 Ga0495684_0090440
379 Ga0495614_0004299
380 Ga0495614_0006001
381 Ga0496102_0041503
382 Ga0496104_0095331
383 Ga0496112_0133326
384 Ga0496112_0168641
385 Ga0501033_0124743
386 Ga0501042_0009817
387 Ga0501043_0045292
388 Ga0501048_0028418
389 Ga0501072_0046527
390 Ga0501075_0020316
391 Ga0501077_0016970
392 Ga0501035_0014954
393 Ga0501044_0006131
394 Ga0501045_0069001
395 nmdc:mga05p37_1526_c1
396 nmdc:mga05p37_166891_c1
397 nmdc:mga0qj67_21091_c1
398 nmdc:mga06r32_5849_c1
399 nmdc:mga08y16_63710_c1
400 nmdc:mga0n895_97896_c1
401 nmdc:mga0rr50_14212_c1
402 nmdc:mga0rr50_152188_c1
403 nmdc:mga0rr50_41490_c1
404 nmdc:mga08x19_10200_c1
405 nmdc:mga08x19_37670_c1
406 nmdc:mga0a205_30002_c1
407 Ga0495612_0026705
408 Ga0500641_0003747
409 2808967868
410 2867478934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02133

Transp_cyt_pur

Permease for cytosine/purines, uracil, thiamine, allantoin

38

489

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x79-assembly1.cif.gz_A inward facing conformation of mhp1 0.8614 5 475
2jln-assembly1.cif.gz_A structure of mhp1, a nucleobase-cation-symport-1 family transporter 0.8382 5 475
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.8261 10 478
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.8166 10 478
2x79-assembly1.cif.gz_A inward facing conformation of mhp1 0.8094 5 475
ID Description Score Start End Superfamily
af_I1L943_79_546_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.9454 3 468 1.10.4160.10
af_I1L943_79_546_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.9336 3 468 1.10.4160.10
af_P75712_7_482_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.9295 7 475 1.10.4160.10
af_Q05998_19_505_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.9263 6 478 1.10.4160.10
af_P38196_104_581_1.10.4160.10 Mainly Alpha;Orthogonal Bundle;Hydantoin permease;Hydantoin permease 0.9189 6 467 1.10.4160.10
ID Description Score Start End GO Terms
AF-A0A661MZV5-F1-model_v4 Nitrate reductase 0.9852 3 380 GO:0005886
GO:0015205
AF-A0A522AMH4-F1-model_v4 Nitrate reductase 0.9769 2 429 GO:0005886
GO:0015205
AF-A0A7G9RLN7-F1-model_v4 NCS1 family nucleobase:cation symporter-1 0.9767 1 481 GO:0005886
GO:0015205
AF-A0A7V7XC35-F1-model_v4 deleted 0.9763 4 475
AF-A2W5S5-F1-model_v4 deleted 0.9751 2 475

Map