F314172

General Info

Members Datasets Scaffolds Average Seq Length
205 146 410 276

Family's Representative Sequence

Representative Sequence 3300041997|Ga0439431_0000545|Ga0439431_0000545_2568_3461
Length 297
Sequence MFNNSSKQNDPRMNTIRIYKTPGTLLAFYQEQYYSFLTDWNSFVNRKGLFQSVVADLAGKTPMDKTAAEKIIANGLEAPIASQEVWAAGVTYFRSRTARMEESEDAGGATFYDKVYVAERPELFFKATPHRVSGHQQTVYIREDSSWDVPEPELTLFVSSYGTIEGYTVGNDMSSRSIEGENPLYLPQAKVYEKCAGLGPCLLVTDAPIPPDTLIRMAIYRGETQQYADSVTISQMKRSHQELVDYLFRGCAFPDGCYLMTGTCLVPENSFTLQDDDRVEISIDHIGTLINNVQTMH

Samples

Sample ID Description Type Environment
1 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
129 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
130 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
131 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
141 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
142 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
143 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
144 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
145 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
146 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 0
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 2.44
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439431_0000545 3300041997 Bacteria 8005
2 JGI25160J50197_1005338 3300003354 Bacteria 5367
3 Ga0065712_10076051 3300005290 Unclassified 3729
4 Ga0065712_10080893 3300005290 Bacteria 3060
5 Ga0070658_10036217 3300005327 Bacteria 3977
6 Ga0070683_100019483 3300005329 Bacteria 6026
7 Ga0070690_100158235 3300005330 Unclassified 1550
8 Ga0070670_100077648 3300005331 Bacteria 2853
9 Ga0068869_100095352 3300005334 Bacteria 2245
10 Ga0068869_100422836 3300005334 Bacteria 1100
11 Ga0070666_10467593 3300005335 Unclassified 912
12 Ga0070689_100102883 3300005340 Bacteria 2263
13 Ga0070687_100070919 3300005343 Unclassified 1870
14 Ga0070661_100378198 3300005344 Bacteria 1116
15 Ga0070692_10099906 3300005345 Unclassified 1589
16 Ga0070675_100588237 3300005354 Unclassified 1009
17 Ga0070675_100593831 3300005354 Bacteria 1004
18 Ga0070671_100171880 3300005355 Bacteria 1833
19 Ga0070671_100532258 3300005355 Bacteria 1012
20 Ga0070674_100527185 3300005356 Unclassified 988
21 Ga0070674_100531175 3300005356 Bacteria 984
22 Ga0070673_100153826 3300005364 Bacteria 1950
23 Ga0070667_100336824 3300005367 Unclassified 1364
24 Ga0070713_100000096 3300005436 Bacteria 56528
25 Ga0070710_10009392 3300005437 Bacteria 4783
26 Ga0070711_100068994 3300005439 Bacteria 2486
27 Ga0070708_100044688 3300005445 Bacteria 3897
28 Ga0070663_100433317 3300005455 Bacteria 1080
29 Ga0070662_100332068 3300005457 Unclassified 1242
30 Ga0068867_100071512 3300005459 Bacteria 2595
31 Ga0068867_100595886 3300005459 Bacteria 963
32 Ga0070685_10036529 3300005466 Unclassified 2778
33 Ga0070707_100001491 3300005468 Bacteria 22835
34 Ga0070698_100061190 3300005471 Bacteria 3799
35 Ga0070698_100108845 3300005471 Bacteria 2738
36 Ga0070699_100324266 3300005518 Bacteria 1385
37 Ga0070672_100594149 3300005543 Bacteria 964
38 Ga0070686_100035267 3300005544 Unclassified 3088
39 Ga0070695_100209497 3300005545 Unclassified 1398
40 Ga0070693_100123703 3300005547 Unclassified 1608
41 Ga0070693_100463151 3300005547 Bacteria 892
42 Ga0070665_100378564 3300005548 Bacteria 1423
43 Ga0070665_100627596 3300005548 Bacteria 1088
44 Ga0070664_100041844 3300005564 Bacteria 3867
45 Ga0068857_100068038 3300005577 Bacteria 3171
46 Ga0068857_100535538 3300005577 Bacteria 1102
47 Ga0070702_100005760 3300005615 Bacteria 5806
48 Ga0070702_100214607 3300005615 Bacteria 1283
49 Ga0070702_100355862 3300005615 Bacteria 1033
50 Ga0068859_100011483 3300005617 Bacteria 8906
51 Ga0068859_100135730 3300005617 Bacteria 2533
52 Ga0068859_100289482 3300005617 Bacteria 1731
53 Ga0068864_100008188 3300005618 Bacteria 8620
54 Ga0068864_100207329 3300005618 Unclassified 1803
55 Ga0068864_100215821 3300005618 Bacteria 1768
56 Ga0068864_100298320 3300005618 Unclassified 1508
57 Ga0068861_100022756 3300005719 Unclassified 4519
58 Ga0068858_100029584 3300005842 Bacteria 5087
59 Ga0068860_100015198 3300005843 Bacteria 7520
60 Ga0081455_10004301 3300005937 Bacteria 16033
61 Ga0081539_10001880 3300005985 Bacteria 32861
62 Ga0081539_10094019 3300005985 Bacteria 1543
63 Ga0070716_100002127 3300006173 Bacteria 9097
64 Ga0070712_100000423 3300006175 Bacteria 24263
65 Ga0070712_100327342 3300006175 Bacteria 1247
66 Ga0097621_100057159 3300006237 Bacteria 3189
67 Ga0097621_100369159 3300006237 Bacteria 1280
68 Ga0075428_100102630 3300006844 Bacteria 3119
69 Ga0075428_100710402 3300006844 Bacteria 1071
70 Ga0075430_100232678 3300006846 Bacteria 1528
71 Ga0075431_100017424 3300006847 Bacteria 7299
72 Ga0075431_100021550 3300006847 Bacteria 6591
73 Ga0075434_100037313 3300006871 Bacteria 4810
74 Ga0075434_100207159 3300006871 Bacteria 1982
75 Ga0075434_100304556 3300006871 Bacteria 1614
76 Ga0075434_100781044 3300006871 Bacteria 972
77 Ga0075429_100194284 3300006880 Bacteria 1778
78 Ga0075429_100378246 3300006880 Bacteria 1240
79 Ga0068865_100086059 3300006881 Unclassified 2268
80 Ga0097620_100011482 3300006931 Bacteria 8906
81 Ga0097620_100135727 3300006931 Bacteria 2533
82 Ga0097620_100289483 3300006931 Bacteria 1731
83 Ga0111539_10047161 3300009094 Bacteria 5151
84 Ga0111539_10296226 3300009094 Unclassified 1883
85 Ga0105245_10028549 3300009098 Unclassified 4923
86 Ga0114129_10236789 3300009147 Bacteria 2456
87 Ga0114129_10344222 3300009147 Bacteria 1976
88 Ga0105243_10184979 3300009148 Bacteria 1815
89 Ga0105241_10234682 3300009174 Unclassified 1548
90 Ga0105241_10326907 3300009174 Unclassified 1324
91 Ga0105242_10014776 3300009176 Bacteria 6046
92 Ga0105248_10009881 3300009177 Bacteria 10507
93 Ga0105248_10071205 3300009177 Unclassified 3905
94 Ga0105249_10008421 3300009553 Bacteria 8985
95 Ga0105249_10191224 3300009553 Unclassified 1998
96 Ga0105239_10141191 3300010375 Bacteria 2684
97 Ga0157374_10003487 3300013296 Bacteria 13223
98 Ga0157374_10025982 3300013296 Bacteria 5264
99 Ga0157374_10178948 3300013296 Unclassified 2071
100 Ga0163162_10030916 3300013306 Bacteria 5308
101 Ga0163162_10093256 3300013306 Unclassified 3095
102 Ga0157375_10018350 3300013308 Bacteria 6344
103 Ga0157375_10327413 3300013308 Bacteria 1697
104 Ga0157375_10913600 3300013308 Bacteria 1021
105 Ga0163163_10001292 3300014325 Bacteria 21162
106 Ga0163163_10076879 3300014325 Unclassified 3334
107 Ga0163163_10534226 3300014325 Bacteria 1235
108 Ga0157380_10358722 3300014326 Bacteria 1367
109 Ga0157376_10012124 3300014969 Bacteria 6385
110 Ga0157376_10048303 3300014969 Bacteria 3518
111 Ga0157376_10608535 3300014969 Bacteria 1088
112 Ga0213873_10009323 3300021358 Bacteria 2034
113 Ga0213876_10000351 3300021384 Bacteria 39846
114 Ga0213871_10042221 3300021441 Bacteria 1227
115 Ga0209436_100671 3300025208 Bacteria 14564
116 Ga0209130_1010420 3300025284 Bacteria 2561
117 Ga0207426_1000073 3300025302 Bacteria 323756
118 Ga0207697_10014137 3300025315 Unclassified 3318
119 Ga0207697_10019143 3300025315 Bacteria 2804
120 Ga0207692_10013801 3300025898 Bacteria 3514
121 Ga0207642_10107901 3300025899 Unclassified 1411
122 Ga0207688_10003387 3300025901 Bacteria 8695
123 Ga0207680_10058081 3300025903 Unclassified 2344
124 Ga0207699_10003068 3300025906 Bacteria 7933
125 Ga0207705_10015023 3300025909 Bacteria 5567
126 Ga0207693_10000796 3300025915 Bacteria 28162
127 Ga0207693_10297354 3300025915 Bacteria 1265
128 Ga0207663_10073768 3300025916 Bacteria 2210
129 Ga0207662_10029347 3300025918 Unclassified 3186
130 Ga0207649_10314654 3300025920 Bacteria 1148
131 Ga0207646_10002225 3300025922 Bacteria 23107
132 Ga0207681_10131537 3300025923 Bacteria 1851
133 Ga0207650_10010283 3300025925 Bacteria 6414
134 Ga0207659_10165479 3300025926 Bacteria 1740
135 Ga0207700_10001806 3300025928 Bacteria 12157
136 Ga0207644_10134456 3300025931 Unclassified 1897
137 Ga0207644_10273228 3300025931 Unclassified 1355
138 Ga0207704_10129338 3300025938 Unclassified 1745
139 Ga0207665_10000794 3300025939 Bacteria 21330
140 Ga0207665_10466072 3300025939 Bacteria 971
141 Ga0207711_10082612 3300025941 Unclassified 2808
142 Ga0207689_10124985 3300025942 Bacteria 2116
143 Ga0207689_10402647 3300025942 Unclassified 1141
144 Ga0207661_10027618 3300025944 Bacteria 4337
145 Ga0207661_10513096 3300025944 Bacteria 1096
146 Ga0207679_10496186 3300025945 Bacteria 1089
147 Ga0207651_10295253 3300025960 Unclassified 1345
148 Ga0207677_10299666 3300026023 Unclassified 1327
149 Ga0207678_10305840 3300026067 Bacteria 1367
150 Ga0207708_10266394 3300026075 Bacteria 1384
151 Ga0207641_10154722 3300026088 Bacteria 2080
152 Ga0207648_10344872 3300026089 Bacteria 1342
153 Ga0207676_10005509 3300026095 Bacteria 8957
154 Ga0207676_10171641 3300026095 Unclassified 1890
155 Ga0207674_10020292 3300026116 Bacteria 7183
156 Ga0207674_10085934 3300026116 Bacteria 3140
157 Ga0207674_10207353 3300026116 Bacteria 1909
158 Ga0207675_100010935 3300026118 Bacteria 8501
159 Ga0207675_100338242 3300026118 Bacteria 1473
160 Ga0207683_10160776 3300026121 Bacteria 2030
161 Ga0207428_10029320 3300027907 Bacteria 4562
162 Ga0268266_10300740 3300028379 Bacteria 1497
163 Ga0268265_10383864 3300028380 Bacteria 1293
164 Ga0265314_10010679 3300031711 Bacteria 7641
165 Ga0307411_10404789 3300032005 Bacteria 1129
166 Ga0373937_0112193 3300036401 Bacteria 2536
167 Ga0436365_0277129 3300039437 Bacteria 40612
168 Ga0436360_1262277 3300039438 Bacteria 13311
169 Ga0436362_1077000 3300039453 Bacteria 2019
170 Ga0466972_0019143 3300044658 Bacteria 3423
171 Ga0453684_0521990 3300044712 Bacteria 1312
172 Ga0466959_0052784 3300045049 Bacteria 2976
173 Ga0495625_0023026 3300046660 Bacteria 4764
174 Ga0496104_0492850 3300048907 Bacteria 1137
175 Ga0496109_0000068 3300048912 Bacteria 110206
176 Ga0496109_0211683 3300048912 Bacteria 1823
177 Ga0496110_0180109 3300048913 Bacteria 1919
178 Ga0496115_0368090 3300048918 Bacteria 1170
179 Ga0501290_004778 3300049513 Bacteria 1692
180 Ga0501039_0689375 3300049575 Bacteria 799
181 Ga0501198_015886 3300049649 Unclassified 1159
182 Ga0501202_021370 3300049652 Unclassified 1293
183 Ga0501222_001444 3300049662 Bacteria 3330
184 Ga0501242_004697 3300049674 Unclassified 1522
185 nmdc:mga05p37_191701_c1 3300050507 Bacteria 2481
186 nmdc:mga05p37_27893_c1 3300050507 Bacteria 6879
187 nmdc:mga09592_245708_c1 3300050508 Bacteria 1551
188 nmdc:mga06r32_10160_c1 3300050510 Bacteria 8496
189 nmdc:mga06r32_16824_c1 3300050510 Bacteria 6668
190 nmdc:mga08y16_29818_c1 3300050511 Bacteria 5744
191 nmdc:mga08y16_42781_c1 3300050511 Bacteria 4744
192 nmdc:mga0n895_117845_c1 3300050512 Bacteria 2675
193 nmdc:mga0n895_124242_c1 3300050512 Bacteria 2603
194 nmdc:mga0a205_11102_c1 3300050515 Bacteria 8288
195 nmdc:mga0a205_206953_c1 3300050515 Bacteria 1851
196 nmdc:mga0a205_34479_c1 3300050515 Bacteria 4854
197 Ga0500555_044052 3300053103 Bacteria 1235
198 Ga0501084_0554073 3300054114 Bacteria 971
199 2819678836 2818991460 Bacteria 7595395
200 2883068941 2883068021 Bacteria 6192739
201 2896088860 2896085136 Bacteria 6129793
202 2896111433 2896109856 Bacteria 7140722
203 2929182241 2929177148 Bacteria 7883697
204 2945978159 2945977869 Bacteria 7777518
205 2946015979 2946013367 Bacteria 7766675
206 Ga0439431_0000545
207 JGI25160J50197_1005338
208 Ga0065712_10076051
209 Ga0065712_10080893
210 Ga0070658_10036217
211 Ga0070683_100019483
212 Ga0070690_100158235
213 Ga0070670_100077648
214 Ga0068869_100095352
215 Ga0068869_100422836
216 Ga0070666_10467593
217 Ga0070689_100102883
218 Ga0070687_100070919
219 Ga0070661_100378198
220 Ga0070692_10099906
221 Ga0070675_100588237
222 Ga0070675_100593831
223 Ga0070671_100171880
224 Ga0070671_100532258
225 Ga0070674_100527185
226 Ga0070674_100531175
227 Ga0070673_100153826
228 Ga0070667_100336824
229 Ga0070713_100000096
230 Ga0070710_10009392
231 Ga0070711_100068994
232 Ga0070708_100044688
233 Ga0070663_100433317
234 Ga0070662_100332068
235 Ga0068867_100071512
236 Ga0068867_100595886
237 Ga0070685_10036529
238 Ga0070707_100001491
239 Ga0070698_100061190
240 Ga0070698_100108845
241 Ga0070699_100324266
242 Ga0070672_100594149
243 Ga0070686_100035267
244 Ga0070695_100209497
245 Ga0070693_100123703
246 Ga0070693_100463151
247 Ga0070665_100378564
248 Ga0070665_100627596
249 Ga0070664_100041844
250 Ga0068857_100068038
251 Ga0068857_100535538
252 Ga0070702_100005760
253 Ga0070702_100214607
254 Ga0070702_100355862
255 Ga0068859_100011483
256 Ga0068859_100135730
257 Ga0068859_100289482
258 Ga0068864_100008188
259 Ga0068864_100207329
260 Ga0068864_100215821
261 Ga0068864_100298320
262 Ga0068861_100022756
263 Ga0068858_100029584
264 Ga0068860_100015198
265 Ga0081455_10004301
266 Ga0081539_10001880
267 Ga0081539_10094019
268 Ga0070716_100002127
269 Ga0070712_100000423
270 Ga0070712_100327342
271 Ga0097621_100057159
272 Ga0097621_100369159
273 Ga0075428_100102630
274 Ga0075428_100710402
275 Ga0075430_100232678
276 Ga0075431_100017424
277 Ga0075431_100021550
278 Ga0075434_100037313
279 Ga0075434_100207159
280 Ga0075434_100304556
281 Ga0075434_100781044
282 Ga0075429_100194284
283 Ga0075429_100378246
284 Ga0068865_100086059
285 Ga0097620_100011482
286 Ga0097620_100135727
287 Ga0097620_100289483
288 Ga0111539_10047161
289 Ga0111539_10296226
290 Ga0105245_10028549
291 Ga0114129_10236789
292 Ga0114129_10344222
293 Ga0105243_10184979
294 Ga0105241_10234682
295 Ga0105241_10326907
296 Ga0105242_10014776
297 Ga0105248_10009881
298 Ga0105248_10071205
299 Ga0105249_10008421
300 Ga0105249_10191224
301 Ga0105239_10141191
302 Ga0157374_10003487
303 Ga0157374_10025982
304 Ga0157374_10178948
305 Ga0163162_10030916
306 Ga0163162_10093256
307 Ga0157375_10018350
308 Ga0157375_10327413
309 Ga0157375_10913600
310 Ga0163163_10001292
311 Ga0163163_10076879
312 Ga0163163_10534226
313 Ga0157380_10358722
314 Ga0157376_10012124
315 Ga0157376_10048303
316 Ga0157376_10608535
317 Ga0213873_10009323
318 Ga0213876_10000351
319 Ga0213871_10042221
320 Ga0209436_100671
321 Ga0209130_1010420
322 Ga0207426_1000073
323 Ga0207697_10014137
324 Ga0207697_10019143
325 Ga0207692_10013801
326 Ga0207642_10107901
327 Ga0207688_10003387
328 Ga0207680_10058081
329 Ga0207699_10003068
330 Ga0207705_10015023
331 Ga0207693_10000796
332 Ga0207693_10297354
333 Ga0207663_10073768
334 Ga0207662_10029347
335 Ga0207649_10314654
336 Ga0207646_10002225
337 Ga0207681_10131537
338 Ga0207650_10010283
339 Ga0207659_10165479
340 Ga0207700_10001806
341 Ga0207644_10134456
342 Ga0207644_10273228
343 Ga0207704_10129338
344 Ga0207665_10000794
345 Ga0207665_10466072
346 Ga0207711_10082612
347 Ga0207689_10124985
348 Ga0207689_10402647
349 Ga0207661_10027618
350 Ga0207661_10513096
351 Ga0207679_10496186
352 Ga0207651_10295253
353 Ga0207677_10299666
354 Ga0207678_10305840
355 Ga0207708_10266394
356 Ga0207641_10154722
357 Ga0207648_10344872
358 Ga0207676_10005509
359 Ga0207676_10171641
360 Ga0207674_10020292
361 Ga0207674_10085934
362 Ga0207674_10207353
363 Ga0207675_100010935
364 Ga0207675_100338242
365 Ga0207683_10160776
366 Ga0207428_10029320
367 Ga0268266_10300740
368 Ga0268265_10383864
369 Ga0265314_10010679
370 Ga0307411_10404789
371 Ga0373937_0112193
372 Ga0436365_0277129
373 Ga0436360_1262277
374 Ga0436362_1077000
375 Ga0466972_0019143
376 Ga0453684_0521990
377 Ga0466959_0052784
378 Ga0495625_0023026
379 Ga0496104_0492850
380 Ga0496109_0000068
381 Ga0496109_0211683
382 Ga0496110_0180109
383 Ga0496115_0368090
384 Ga0501290_004778
385 Ga0501039_0689375
386 Ga0501198_015886
387 Ga0501202_021370
388 Ga0501222_001444
389 Ga0501242_004697
390 nmdc:mga05p37_191701_c1
391 nmdc:mga05p37_27893_c1
392 nmdc:mga09592_245708_c1
393 nmdc:mga06r32_10160_c1
394 nmdc:mga06r32_16824_c1
395 nmdc:mga08y16_29818_c1
396 nmdc:mga08y16_42781_c1
397 nmdc:mga0n895_117845_c1
398 nmdc:mga0n895_124242_c1
399 nmdc:mga0a205_11102_c1
400 nmdc:mga0a205_206953_c1
401 nmdc:mga0a205_34479_c1
402 Ga0500555_044052
403 Ga0501084_0554073
404 2819678836
405 2883068941
406 2896088860
407 2896111433
408 2929182241
409 2945978159
410 2946015979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

89

294

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8483 1 286
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8482 1 286
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8481 1 286
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8455 1 286
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8454 1 286
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9413 68 286 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.937 68 286 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8473 68 284 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8433 68 284 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8271 68 284 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A3N7H8V0-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9915 5 284 GO:0016853
GO:0044281
AF-A0A537JWX1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9896 148 283 GO:0016853
GO:0044281
AF-A0A7K1XYB8-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9864 5 284 GO:0016853
GO:0044281
AF-A0A3B9G7U1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9851 104 282 GO:0016853
GO:0044281
AF-A0A1M5FHM7-F1-model_v4 2-dehydro-3-deoxy-D-arabinonate dehydratase 0.9849 2 282 GO:0003824
GO:0044281

Map