F314154

General Info

Members Datasets Scaffolds Average Seq Length
205 153 410 251

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0013948|Ga0439439_0013948_738_1604
Length 288
Sequence MRDKVYVLGTPVHNLTMLETINLVDDAISNKRHIHHSVVNAGKIVAMHENQELRESVINADIINADGQAVVWTSKIFGQPLKERVTGSDLMEKVVELAYQKNYTIFFLGAKEEILKKVINKYSGQYSPKIIAGYRNGYFNKEEEREVVQQIADSKANILFVAISSPVKENLLFQNRDILKNINFIMGVGGSFDVVAGHVKRAPLWIQKLGLEWFYRVWQEPKRMFKRYLVGNLKFIGLIFRYILFNYKLLQPSKYSSNVPLEIGVINPFIPKRKRKREHHNILTKFTD

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
80 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
81 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
82 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
83 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
142 2511231015 Pseudomonas sp. GM49 Isolate Nodule
143 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
144 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
145 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
146 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
147 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
148 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
149 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
150 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
151 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
152 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
153 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.15
Metatranscriptomes 0
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 1.95
Rhizoplane 3.41
Rhizosphere 81.46
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0013948 3300041406 Bacteria 1953
2 JGI24740J21852_10000319 3300001979 Bacteria 20469
3 JGI24739J22299_10002347 3300001989 Bacteria 7290
4 JGI24735J21928_10035616 3300002067 Bacteria 1463
5 JGI25156J39149_1000195 3300002705 Bacteria 42411
6 rootH1_10233157 3300003323 Bacteria 6037
7 Ga0065712_10073624 3300005290 Bacteria 4330
8 Ga0065712_10074574 3300005290 Bacteria 4038
9 Ga0065707_10083137 3300005295 Bacteria 10273
10 Ga0070660_100000003 3300005339 Bacteria 176884
11 Ga0070689_100261068 3300005340 Bacteria 1432
12 Ga0070691_10125358 3300005341 Bacteria 1297
13 Ga0070687_100091860 3300005343 Bacteria 1681
14 Ga0070692_10317096 3300005345 Bacteria 957
15 Ga0070669_100039977 3300005353 Bacteria 3408
16 Ga0070669_100137589 3300005353 Bacteria 1880
17 Ga0070669_100466301 3300005353 Bacteria 1043
18 Ga0070659_100000914 3300005366 Bacteria 21609
19 Ga0070663_100000043 3300005455 Bacteria 57818
20 Ga0070685_10000972 3300005466 Bacteria 15420
21 Ga0068853_100072753 3300005539 Bacteria 2996
22 Ga0068853_100133421 3300005539 Unclassified 2224
23 Ga0070665_100000018 3300005548 Bacteria 434118
24 Ga0068855_100003082 3300005563 Bacteria 20392
25 Ga0068856_100575530 3300005614 Bacteria 1147
26 Ga0068852_100008616 3300005616 Bacteria 7531
27 Ga0068859_100051576 3300005617 Bacteria 4135
28 Ga0068859_100489741 3300005617 Bacteria 1325
29 Ga0068861_100021485 3300005719 Unclassified 4638
30 Ga0068861_100043602 3300005719 Bacteria 3368
31 Ga0068863_100059305 3300005841 Bacteria 3621
32 Ga0068858_100069590 3300005842 Bacteria 3262
33 Ga0068860_100000040 3300005843 Bacteria 231652
34 Ga0068860_100109661 3300005843 Bacteria 2638
35 Ga0075432_10064486 3300006058 Bacteria 1308
36 Ga0075428_100477274 3300006844 Bacteria 1335
37 Ga0097620_100051578 3300006931 Bacteria 4135
38 Ga0097620_100489677 3300006931 Bacteria 1325
39 Ga0105251_10112493 3300009011 Bacteria 1239
40 Ga0105244_10024195 3300009036 Bacteria 3317
41 Ga0105250_10038545 3300009092 Bacteria 1916
42 Ga0105240_10000472 3300009093 Bacteria 74359
43 Ga0105240_10005765 3300009093 Bacteria 18370
44 Ga0111539_10054625 3300009094 Bacteria 4752
45 Ga0111539_10064652 3300009094 Bacteria 4326
46 Ga0105241_10000740 3300009174 Bacteria 24823
47 Ga0105237_10003866 3300009545 Bacteria 17600
48 Ga0105237_10003930 3300009545 Bacteria 17405
49 Ga0105238_10000689 3300009551 Bacteria 35468
50 Ga0105238_10010135 3300009551 Bacteria 9450
51 Ga0105249_10002648 3300009553 Bacteria 15487
52 Ga0105239_10002007 3300010375 Bacteria 26432
53 Ga0105239_10203437 3300010375 Unclassified 2219
54 Ga0157373_10078531 3300013100 Bacteria 2327
55 Ga0157370_10001947 3300013104 Bacteria 25412
56 Ga0157369_10038775 3300013105 Bacteria 5209
57 Ga0163162_10003395 3300013306 Bacteria 15210
58 Ga0163162_10046462 3300013306 Bacteria 4352
59 Ga0163162_10455545 3300013306 Bacteria 1411
60 Ga0157372_10064317 3300013307 Unclassified 4116
61 Ga0157375_10060419 3300013308 Bacteria 3758
62 Ga0157375_10124110 3300013308 Bacteria 2695
63 Ga0157375_10437654 3300013308 Bacteria 1473
64 Ga0182005_1000433 3300015265 Bacteria 22193
65 Ga0182005_1052885 3300015265 Bacteria 1106
66 Ga0163161_10024147 3300017792 Bacteria 4293
67 Ga0163161_10047517 3300017792 Bacteria 3099
68 Ga0209435_106212 3300025206 Bacteria 1331
69 Ga0209759_1000252 3300025256 Bacteria 79418
70 Ga0207656_10147110 3300025321 Bacteria 1113
71 Ga0207655_1050007 3300025728 Unclassified 1702
72 Ga0207713_1001669 3300025735 Bacteria 17198
73 Ga0207647_10129759 3300025904 Bacteria 1482
74 Ga0207654_10016575 3300025911 Unclassified 3839
75 Ga0207695_10001656 3300025913 Bacteria 35897
76 Ga0207695_10018998 3300025913 Bacteria 7926
77 Ga0207671_10001955 3300025914 Bacteria 22731
78 Ga0207671_10055150 3300025914 Bacteria 2945
79 Ga0207657_10000002 3300025919 Bacteria 444378
80 Ga0207681_10090666 3300025923 Bacteria 2182
81 Ga0207681_10449011 3300025923 Bacteria 1049
82 Ga0207694_10008659 3300025924 Bacteria 7683
83 Ga0207694_10033735 3300025924 Bacteria 3921
84 Ga0207690_10000014 3300025932 Bacteria 263016
85 Ga0207667_10003839 3300025949 Bacteria 18470
86 Ga0207712_10003841 3300025961 Bacteria 9488
87 Ga0207703_10043233 3300026035 Bacteria 3615
88 Ga0207678_10000113 3300026067 Bacteria 66664
89 Ga0207702_10400351 3300026078 Bacteria 1324
90 Ga0207641_10035175 3300026088 Bacteria 4172
91 Ga0207675_100023311 3300026118 Bacteria 5756
92 Ga0207675_100027515 3300026118 Bacteria 5295
93 Ga0207698_10004890 3300026142 Bacteria 8216
94 Ga0207428_10028590 3300027907 Bacteria 4631
95 Ga0268266_10000026 3300028379 Bacteria 434485
96 Ga0268264_10000015 3300028381 Bacteria 508501
97 Ga0268264_10000019 3300028381 Bacteria 488112
98 Ga0268264_10000054 3300028381 Bacteria 317048
99 Ga0265338_10000476 3300028800 Bacteria 71490
100 Ga0439438_000313 3300041405 Bacteria 21914
101 Ga0439447_000191 3300041407 Bacteria 21853
102 Ga0439466_0007955 3300041411 Bacteria 3998
103 Ga0439449_0003028 3300042007 Bacteria 6557
104 Ga0439457_005634 3300042014 Bacteria 3126
105 Ga0450922_000202 3300042124 Bacteria 6326
106 Ga0450906_028733 3300042145 Unclassified 984
107 Ga0450907_000411 3300042146 Bacteria 12887
108 Ga0450910_000051 3300042147 Bacteria 12140
109 Ga0450908_000330 3300042184 Bacteria 9268
110 Ga0450908_003352 3300042184 Bacteria 3110
111 Ga0451577_0009221 3300042876 Bacteria 9517
112 Ga0451577_0020811 3300042876 Bacteria 6014
113 Ga0453683_0000194 3300044673 Bacteria 83328
114 Ga0453683_0024140 3300044673 Bacteria 3872
115 Ga0453683_0182922 3300044673 Unclassified 1329
116 Ga0466960_0059148 3300044901 Bacteria 1874
117 Ga0451576_0000135 3300045051 Bacteria 186763
118 Ga0451576_0003115 3300045051 Bacteria 23259
119 Ga0451576_0045361 3300045051 Bacteria 4630
120 Ga0451576_0057159 3300045051 Unclassified 4078
121 Ga0451576_0128570 3300045051 Bacteria 2640
122 Ga0495638_0029427 3300046460 Unclassified 3542
123 Ga0495638_0038798 3300046460 Unclassified 3025
124 Ga0495651_0087480 3300046462 Bacteria 2343
125 Ga0495653_0155096 3300046463 Bacteria 1596
126 Ga0495580_0000295 3300046472 Bacteria 40524
127 Ga0495584_0000752 3300046491 Bacteria 21406
128 Ga0495585_0000361 3300046492 Bacteria 44106
129 Ga0495606_0004959 3300046507 Bacteria 12995
130 Ga0495616_0000487 3300046513 Bacteria 30232
131 Ga0495620_0007107 3300046515 Bacteria 6101
132 Ga0495630_0004485 3300046517 Bacteria 9787
133 Ga0495637_0000741 3300046520 Bacteria 22158
134 Ga0495648_0001332 3300046524 Bacteria 24462
135 Ga0495648_0105544 3300046524 Bacteria 1544
136 Ga0495668_0001793 3300046616 Bacteria 19612
137 Ga0495611_0180256 3300046648 Unclassified 987
138 Ga0495661_0012722 3300046665 Bacteria 5680
139 Ga0495599_0000510 3300046678 Bacteria 22180
140 Ga0495599_0001488 3300046678 Bacteria 13450
141 Ga0495599_0002857 3300046678 Bacteria 10067
142 Ga0495599_0072849 3300046678 Bacteria 2144
143 Ga0495623_0067775 3300046679 Bacteria 2227
144 Ga0495646_0034323 3300046680 Bacteria 3151
145 Ga0495646_0056672 3300046680 Bacteria 2349
146 Ga0495646_0438428 3300046680 Bacteria 676
147 Ga0495624_0002077 3300046690 Bacteria 15270
148 Ga0495671_0002072 3300046692 Bacteria 12868
149 Ga0495660_0003223 3300046810 Bacteria 10136
150 Ga0495581_0234639 3300047315 Unclassified 1073
151 Ga0495604_0102653 3300047317 Bacteria 2099
152 Ga0495636_0003972 3300047318 Bacteria 5778
153 Ga0495672_0001008 3300047320 Bacteria 29092
154 Ga0495672_0224331 3300047320 Bacteria 926
155 Ga0495680_0254365 3300047322 Bacteria 1244
156 Ga0495680_0288079 3300047322 Bacteria 1156
157 Ga0495687_000031 3300047443 Bacteria 274659
158 Ga0495675_0014104 3300047444 Bacteria 5052
159 Ga0495673_0001216 3300047469 Bacteria 21415
160 Ga0495684_0216121 3300047471 Unclassified 1408
161 Ga0495593_0015209 3300047673 Bacteria 4365
162 Ga0495602_0025305 3300048088 Bacteria 5745
163 Ga0495602_0061689 3300048088 Bacteria 3258
164 Ga0495626_0000150 3300048091 Bacteria 86296
165 Ga0496101_0102603 3300048904 Bacteria 2143
166 Ga0496102_0006332 3300048905 Bacteria 10091
167 Ga0496102_0409728 3300048905 Bacteria 1274
168 Ga0496103_0008069 3300048906 Bacteria 6253
169 Ga0496104_0002412 3300048907 Bacteria 16095
170 Ga0496105_0018571 3300048908 Bacteria 5596
171 Ga0496112_0521050 3300048915 Bacteria 1123
172 Ga0496117_0001730 3300048920 Bacteria 30199
173 Ga0496117_0021271 3300048920 Bacteria 5255
174 Ga0496117_0095641 3300048920 Bacteria 1897
175 Ga0496118_0000671 3300048921 Bacteria 55606
176 Ga0496118_0002098 3300048921 Bacteria 28002
177 Ga0496118_0011070 3300048921 Bacteria 8854
178 Ga0496119_0093960 3300048922 Bacteria 1698
179 Ga0496121_0056738 3300048924 Bacteria 3250
180 Ga0496122_0010868 3300048925 Bacteria 9320
181 Ga0496123_0004511 3300048926 Bacteria 14563
182 Ga0496124_0037247 3300048927 Bacteria 4232
183 Ga0496126_0000032 3300048929 Bacteria 372456
184 Ga0496126_0000423 3300048929 Bacteria 85154
185 Ga0496126_0000598 3300048929 Bacteria 68057
186 Ga0501033_0391946 3300049570 Bacteria 969
187 Ga0501280_015023 3300049776 Bacteria 1106
188 nmdc:mga08y16_26963_c1 3300050511 Bacteria 6055
189 nmdc:mga08y16_98644_c1 3300050511 Bacteria 3042
190 Ga0500583_0198337 3300053092 Bacteria 998
191 Ga0500616_0008093 3300053153 Bacteria 6574
192 Ga0500622_0005405 3300053156 Bacteria 7680
193 Ga0500611_000001 3300053727 Bacteria 385744
194 2511320876 2511231015 Bacteria 6598026
195 2524003789 2523533628 Bacteria 4098242
196 2739201541 2738543004 Bacteria 6381073
197 2746091295 2744054900 Bacteria 8399525
198 2746097728 2744054901 Bacteria 8397047
199 2842325242 2842324504 Bacteria 9364110
200 2842349521 2842348783 Bacteria 9002918
201 2842455241 2842454564 Bacteria 8730687
202 2900638841 2900634093 Bacteria 10263517
203 2939639440 2939636861 Bacteria 6297853
204 642615147 642555113 Bacteria 8214658
205 8020943404 8020938398 Bacteria 7472757
206 Ga0439439_0013948
207 JGI24740J21852_10000319
208 JGI24739J22299_10002347
209 JGI24735J21928_10035616
210 JGI25156J39149_1000195
211 rootH1_10233157
212 Ga0065712_10073624
213 Ga0065712_10074574
214 Ga0065707_10083137
215 Ga0070660_100000003
216 Ga0070689_100261068
217 Ga0070691_10125358
218 Ga0070687_100091860
219 Ga0070692_10317096
220 Ga0070669_100039977
221 Ga0070669_100137589
222 Ga0070669_100466301
223 Ga0070659_100000914
224 Ga0070663_100000043
225 Ga0070685_10000972
226 Ga0068853_100072753
227 Ga0068853_100133421
228 Ga0070665_100000018
229 Ga0068855_100003082
230 Ga0068856_100575530
231 Ga0068852_100008616
232 Ga0068859_100051576
233 Ga0068859_100489741
234 Ga0068861_100021485
235 Ga0068861_100043602
236 Ga0068863_100059305
237 Ga0068858_100069590
238 Ga0068860_100000040
239 Ga0068860_100109661
240 Ga0075432_10064486
241 Ga0075428_100477274
242 Ga0097620_100051578
243 Ga0097620_100489677
244 Ga0105251_10112493
245 Ga0105244_10024195
246 Ga0105250_10038545
247 Ga0105240_10000472
248 Ga0105240_10005765
249 Ga0111539_10054625
250 Ga0111539_10064652
251 Ga0105241_10000740
252 Ga0105237_10003866
253 Ga0105237_10003930
254 Ga0105238_10000689
255 Ga0105238_10010135
256 Ga0105249_10002648
257 Ga0105239_10002007
258 Ga0105239_10203437
259 Ga0157373_10078531
260 Ga0157370_10001947
261 Ga0157369_10038775
262 Ga0163162_10003395
263 Ga0163162_10046462
264 Ga0163162_10455545
265 Ga0157372_10064317
266 Ga0157375_10060419
267 Ga0157375_10124110
268 Ga0157375_10437654
269 Ga0182005_1000433
270 Ga0182005_1052885
271 Ga0163161_10024147
272 Ga0163161_10047517
273 Ga0209435_106212
274 Ga0209759_1000252
275 Ga0207656_10147110
276 Ga0207655_1050007
277 Ga0207713_1001669
278 Ga0207647_10129759
279 Ga0207654_10016575
280 Ga0207695_10001656
281 Ga0207695_10018998
282 Ga0207671_10001955
283 Ga0207671_10055150
284 Ga0207657_10000002
285 Ga0207681_10090666
286 Ga0207681_10449011
287 Ga0207694_10008659
288 Ga0207694_10033735
289 Ga0207690_10000014
290 Ga0207667_10003839
291 Ga0207712_10003841
292 Ga0207703_10043233
293 Ga0207678_10000113
294 Ga0207702_10400351
295 Ga0207641_10035175
296 Ga0207675_100023311
297 Ga0207675_100027515
298 Ga0207698_10004890
299 Ga0207428_10028590
300 Ga0268266_10000026
301 Ga0268264_10000015
302 Ga0268264_10000019
303 Ga0268264_10000054
304 Ga0265338_10000476
305 Ga0439438_000313
306 Ga0439447_000191
307 Ga0439466_0007955
308 Ga0439449_0003028
309 Ga0439457_005634
310 Ga0450922_000202
311 Ga0450906_028733
312 Ga0450907_000411
313 Ga0450910_000051
314 Ga0450908_000330
315 Ga0450908_003352
316 Ga0451577_0009221
317 Ga0451577_0020811
318 Ga0453683_0000194
319 Ga0453683_0024140
320 Ga0453683_0182922
321 Ga0466960_0059148
322 Ga0451576_0000135
323 Ga0451576_0003115
324 Ga0451576_0045361
325 Ga0451576_0057159
326 Ga0451576_0128570
327 Ga0495638_0029427
328 Ga0495638_0038798
329 Ga0495651_0087480
330 Ga0495653_0155096
331 Ga0495580_0000295
332 Ga0495584_0000752
333 Ga0495585_0000361
334 Ga0495606_0004959
335 Ga0495616_0000487
336 Ga0495620_0007107
337 Ga0495630_0004485
338 Ga0495637_0000741
339 Ga0495648_0001332
340 Ga0495648_0105544
341 Ga0495668_0001793
342 Ga0495611_0180256
343 Ga0495661_0012722
344 Ga0495599_0000510
345 Ga0495599_0001488
346 Ga0495599_0002857
347 Ga0495599_0072849
348 Ga0495623_0067775
349 Ga0495646_0034323
350 Ga0495646_0056672
351 Ga0495646_0438428
352 Ga0495624_0002077
353 Ga0495671_0002072
354 Ga0495660_0003223
355 Ga0495581_0234639
356 Ga0495604_0102653
357 Ga0495636_0003972
358 Ga0495672_0001008
359 Ga0495672_0224331
360 Ga0495680_0254365
361 Ga0495680_0288079
362 Ga0495687_000031
363 Ga0495675_0014104
364 Ga0495673_0001216
365 Ga0495684_0216121
366 Ga0495593_0015209
367 Ga0495602_0025305
368 Ga0495602_0061689
369 Ga0495626_0000150
370 Ga0496101_0102603
371 Ga0496102_0006332
372 Ga0496102_0409728
373 Ga0496103_0008069
374 Ga0496104_0002412
375 Ga0496105_0018571
376 Ga0496112_0521050
377 Ga0496117_0001730
378 Ga0496117_0021271
379 Ga0496117_0095641
380 Ga0496118_0000671
381 Ga0496118_0002098
382 Ga0496118_0011070
383 Ga0496119_0093960
384 Ga0496121_0056738
385 Ga0496122_0010868
386 Ga0496123_0004511
387 Ga0496124_0037247
388 Ga0496126_0000032
389 Ga0496126_0000423
390 Ga0496126_0000598
391 Ga0501033_0391946
392 Ga0501280_015023
393 nmdc:mga08y16_26963_c1
394 nmdc:mga08y16_98644_c1
395 Ga0500583_0198337
396 Ga0500616_0008093
397 Ga0500622_0005405
398 Ga0500611_000001
399 2511320876
400 2524003789
401 2739201541
402 2746091295
403 2746097728
404 2842325242
405 2842349521
406 2842455241
407 2900638841
408 2939639440
409 642615147
410 8020943404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03808

Glyco_tran_WecG

Glycosyl transferase WecG/TagA/CpsF family

60

228

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wfg-assembly2.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.966 8 200
5wfg-assembly2.cif.gz_D crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9619 12 200
5wfg-assembly1.cif.gz_C crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9619 12 200
7n41-assembly2.cif.gz_B crystal structure of taga with udp-mannac 0.9617 8 204
5wfg-assembly1.cif.gz_B crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9592 8 200
ID Description Score Start End Superfamily
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.929 65 229 3.40.50.2300
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9183 65 229 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9118 65 230 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8966 65 230 3.40.50.2300
af_O35199_188_301_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6976 95 189 3.40.50.2300
ID Description Score Start End GO Terms
AF-X1VMM3-F1-model_v4 Glycosyltransferase 0.9823 10 251 GO:0009058
GO:0016758
AF-A0A655UMU4-F1-model_v4 deleted 0.9822 8 248
AF-A0A7V3CR72-F1-model_v4 Glycosyltransferase 0.9818 8 248 GO:0009058
GO:0016758
AF-A0A7X8Z1H1-F1-model_v4 WecB/TagA/CpsF family glycosyltransferase 0.9816 23 248 GO:0009058
GO:0016758
AF-A0A2W4M7H5-F1-model_v4 deleted 0.9804 8 243

Map