F314102

General Info

Members Datasets Scaffolds Average Seq Length
205 116 410 327

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0151103|Ga0316582_0151103_472_1455
Length 306
Sequence MQYRELGRTGWKVSAVSFGAWAIGGTWGKVDDSESLAALHRALDLGVNFFDTADVYGDGRSERLLARLRRERKDPFYVATKAGRRLDPHTAAGYNRKNLTAFVERSLKNLAVEAIDLLQLHCPPPEVYYLPEVFGVLDDLAAQGKLRHYGVSVEKVEEALKALEFPNVRTVQIIFNIFRQRPADLFFRQAQQRKVGILARVPLSSGMLTGKFKAESKFSPDDHRAFNRKGEAFDRLIPDGMSMVQMALRWILMFPAVTCAIPGGKRPAQVEENAAAADLPPLPEETMRRIRSLYEKDIKPLVHQYW

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
84 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
85 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
90 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
91 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
92 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
95 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
116 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 91.71
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0151103 3300036647 Bacteria 1570
2 Ga0065704_10149951 3300005289 Bacteria 1438
3 Ga0065715_10123868 3300005293 Bacteria 2168
4 Ga0065715_10178675 3300005293 Bacteria 1491
5 Ga0065707_10103691 3300005295 Bacteria 2735
6 Ga0070666_10034666 3300005335 Unclassified 3345
7 Ga0068868_100064358 3300005338 Bacteria 2911
8 Ga0070661_100091027 3300005344 Bacteria 2259
9 Ga0070673_100244161 3300005364 Bacteria 1563
10 Ga0070705_100242082 3300005440 Bacteria 1261
11 Ga0070694_100009450 3300005444 Bacteria 5982
12 Ga0070708_100009739 3300005445 Bacteria 7757
13 Ga0070706_100051879 3300005467 Unclassified 3786
14 Ga0070706_100053848 3300005467 Bacteria 3714
15 Ga0070706_100099408 3300005467 Unclassified 2703
16 Ga0070707_100053038 3300005468 Bacteria 3887
17 Ga0070707_100063461 3300005468 Unclassified 3545
18 Ga0070698_100043717 3300005471 Unclassified 4592
19 Ga0070699_100002149 3300005518 Bacteria 17845
20 Ga0070699_100003341 3300005518 Bacteria 14198
21 Ga0070699_100074693 3300005518 Bacteria 2950
22 Ga0070699_100125603 3300005518 Bacteria 2258
23 Ga0070697_100005806 3300005536 Bacteria 9521
24 Ga0070697_100085031 3300005536 Unclassified 2610
25 Ga0068853_100086780 3300005539 Bacteria 2745
26 Ga0070686_100083461 3300005544 Bacteria 2121
27 Ga0070665_100125690 3300005548 Bacteria 2567
28 Ga0070665_100439219 3300005548 Bacteria 1314
29 Ga0070704_100128238 3300005549 Bacteria 1961
30 Ga0068855_100046621 3300005563 Bacteria 5123
31 Ga0070664_100047770 3300005564 Bacteria 3617
32 Ga0068856_100036695 3300005614 Bacteria 4806
33 Ga0068856_100055792 3300005614 Bacteria 3899
34 Ga0070702_100237425 3300005615 Bacteria 1228
35 Ga0068859_100004781 3300005617 Bacteria 13779
36 Ga0068859_100015692 3300005617 Bacteria 7611
37 Ga0068859_100055902 3300005617 Bacteria 3971
38 Ga0068859_100384429 3300005617 Unclassified 1499
39 Ga0068864_100001562 3300005618 Bacteria 18856
40 Ga0068864_100105151 3300005618 Bacteria 2509
41 Ga0068864_100453821 3300005618 Bacteria 1226
42 Ga0068860_100019459 3300005843 Bacteria 6582
43 Ga0068860_100167556 3300005843 Bacteria 2121
44 Ga0068862_100052865 3300005844 Bacteria 3476
45 Ga0081539_10003478 3300005985 Bacteria 19239
46 Ga0097621_100005687 3300006237 Bacteria 8801
47 Ga0068871_100026949 3300006358 Bacteria 4490
48 Ga0075431_100002945 3300006847 Bacteria 16483
49 Ga0097620_100004781 3300006931 Bacteria 13779
50 Ga0097620_100015693 3300006931 Bacteria 7611
51 Ga0097620_100055902 3300006931 Bacteria 3971
52 Ga0097620_100384414 3300006931 Unclassified 1499
53 Ga0099794_10000677 3300007265 Bacteria 11399
54 Ga0105240_10005878 3300009093 Bacteria 18173
55 Ga0114129_10023937 3300009147 Bacteria 8654
56 Ga0105243_10000589 3300009148 Bacteria 36445
57 Ga0105242_10000219 3300009176 Bacteria 44949
58 Ga0105248_10001083 3300009177 Bacteria 30101
59 Ga0105248_10038455 3300009177 Bacteria 5354
60 Ga0105237_10114536 3300009545 Bacteria 2689
61 Ga0105238_10147214 3300009551 Unclassified 2331
62 Ga0105249_10251755 3300009553 Bacteria 1751
63 Ga0157369_10000970 3300013105 Bacteria 36370
64 Ga0157374_10089070 3300013296 Bacteria 2940
65 Ga0157378_10005709 3300013297 Bacteria 10890
66 Ga0157378_10187191 3300013297 Bacteria 1950
67 Ga0157378_10548366 3300013297 Bacteria 1161
68 Ga0163162_10003393 3300013306 Bacteria 15213
69 Ga0163162_10348179 3300013306 Unclassified 1614
70 Ga0157372_10031305 3300013307 Bacteria 5825
71 Ga0157375_10368192 3300013308 Bacteria 1603
72 Ga0163163_10001916 3300014325 Bacteria 17611
73 Ga0163163_10042554 3300014325 Unclassified 4449
74 Ga0157380_10036913 3300014326 Bacteria 3784
75 Ga0207680_10037384 3300025903 Bacteria 2802
76 Ga0207684_10001826 3300025910 Bacteria 22233
77 Ga0207684_10007049 3300025910 Bacteria 10166
78 Ga0207684_10044706 3300025910 Unclassified 3756
79 Ga0207695_10009484 3300025913 Bacteria 12037
80 Ga0207649_10076589 3300025920 Bacteria 2153
81 Ga0207646_10006923 3300025922 Bacteria 11642
82 Ga0207646_10152190 3300025922 Bacteria 2086
83 Ga0207694_10114386 3300025924 Unclassified 2149
84 Ga0207686_10000022 3300025934 Bacteria 174346
85 Ga0207709_10000056 3300025935 Bacteria 221962
86 Ga0207711_10231518 3300025941 Bacteria 1692
87 Ga0207661_10109674 3300025944 Bacteria 2332
88 Ga0207679_10153217 3300025945 Bacteria 1879
89 Ga0207679_10206674 3300025945 Bacteria 1644
90 Ga0207667_10016087 3300025949 Bacteria 8467
91 Ga0207651_10216907 3300025960 Bacteria 1544
92 Ga0207712_10065309 3300025961 Unclassified 2597
93 Ga0207639_10046481 3300026041 Bacteria 3275
94 Ga0207639_10091053 3300026041 Bacteria 2441
95 Ga0207702_10026235 3300026078 Bacteria 4836
96 Ga0207676_10016183 3300026095 Bacteria 5398
97 Ga0207676_10122048 3300026095 Unclassified 2199
98 Ga0207675_100003958 3300026118 Bacteria 14375
99 Ga0207683_10197285 3300026121 Bacteria 1829
100 Ga0209588_1005352 3300027671 Bacteria 3674
101 Ga0207428_10035017 3300027907 Bacteria 4108
102 Ga0268266_10448494 3300028379 Bacteria 1226
103 Ga0268264_10184021 3300028381 Bacteria 1900
104 Ga0268264_10350328 3300028381 Bacteria 1405
105 Ga0265338_10000561 3300028800 Bacteria 65218
106 Ga0265338_10015143 3300028800 Bacteria 8506
107 Ga0265325_10072669 3300031241 Bacteria 1723
108 Ga0265316_10003957 3300031344 Bacteria 14840
109 Ga0265316_10021320 3300031344 Bacteria 5490
110 Ga0265316_10065351 3300031344 Bacteria 2817
111 Ga0316575_10019935 3300031665 Bacteria 2568
112 Ga0316575_10023067 3300031665 Bacteria 2404
113 Ga0316579_10000211 3300031691 Bacteria 17438
114 Ga0316579_10000560 3300031691 Bacteria 12402
115 Ga0316579_10017331 3300031691 Bacteria 3157
116 Ga0316576_10003904 3300031727 Bacteria 8837
117 Ga0316576_10017035 3300031727 Bacteria 4928
118 Ga0316576_10026941 3300031727 Bacteria 4038
119 Ga0316576_10117315 3300031727 Bacteria 1997
120 Ga0316576_10141174 3300031727 Bacteria 1814
121 Ga0316578_10003574 3300031728 Bacteria 7145
122 Ga0316578_10022258 3300031728 Bacteria 3531
123 Ga0316577_10000096 3300031733 Bacteria 24105
124 Ga0316577_10051570 3300031733 Bacteria 2295
125 Ga0316577_10057949 3300031733 Bacteria 2162
126 Ga0316577_10090323 3300031733 Bacteria 1714
127 Ga0307409_100479096 3300031995 Bacteria 1207
128 Ga0316583_10015468 3300032133 Bacteria 2746
129 Ga0316585_10020338 3300032137 Bacteria 2031
130 Ga0316585_10026416 3300032137 Bacteria 1806
131 Ga0316585_10062465 3300032137 Bacteria 1204
132 Ga0316580_10020149 3300032139 Bacteria 2053
133 Ga0316574_0023963 3300035398 Bacteria 3648
134 Ga0373937_0253425 3300036401 Bacteria 1659
135 Ga0316582_0000338 3300036647 Bacteria 16533
136 Ga0316582_0001154 3300036647 Bacteria 11270
137 Ga0316582_0004090 3300036647 Bacteria 7297
138 Ga0316582_0008451 3300036647 Bacteria 5536
139 Ga0316582_0010755 3300036647 Bacteria 5026
140 Ga0316582_0134746 3300036647 Bacteria 1661
141 Ga0316582_0139115 3300036647 Bacteria 1636
142 Ga0316582_0173490 3300036647 Bacteria 1465
143 Ga0316582_0192630 3300036647 Unclassified 1389
144 Ga0316582_0193435 3300036647 Bacteria 1386
145 Ga0316582_0226844 3300036647 Bacteria 1278
146 Ga0316584_0000496 3300036712 Bacteria 20763
147 Ga0316584_0001679 3300036712 Bacteria 13532
148 Ga0316584_0004985 3300036712 Bacteria 8843
149 Ga0316584_0017359 3300036712 Bacteria 5171
150 Ga0316584_0048179 3300036712 Bacteria 3184
151 Ga0316584_0080592 3300036712 Bacteria 2439
152 Ga0316584_0349634 3300036712 Bacteria 1061
153 Ga0316581_0000224 3300037588 Bacteria 9666
154 Ga0316581_0012216 3300037588 Bacteria 2415
155 Ga0316581_0027015 3300037588 Bacteria 1715
156 Ga0316581_0029021 3300037588 Unclassified 1660
157 Ga0400484_36301 3300038725 Bacteria 4179
158 Ga0400490_37627 3300038726 Bacteria 1075
159 Ga0400486_25655 3300038742 Bacteria 15276
160 Ga0400483_153720 3300039062 Unclassified 1733
161 Ga0400483_229347 3300039062 Bacteria 13104
162 Ga0400483_289677 3300039062 Bacteria 4220
163 Ga0400489_00747 3300039093 Bacteria 9150
164 Ga0400489_21294 3300039093 Bacteria 3428
165 Ga0400489_36520 3300039093 Bacteria 1587
166 Ga0400489_94892 3300039093 Bacteria 43067
167 Ga0400487_07741 3300039110 Bacteria 15366
168 Ga0451577_0008642 3300042876 Bacteria 9892
169 Ga0451577_0183135 3300042876 Unclassified 1889
170 Ga0451577_0285270 3300042876 Bacteria 1496
171 Ga0451577_0297010 3300042876 Bacteria 1464
172 Ga0453684_0000267 3300044712 Bacteria 225314
173 Ga0453684_0000535 3300044712 Bacteria 144635
174 Ga0453684_0002604 3300044712 Bacteria 43124
175 Ga0453684_0004235 3300044712 Bacteria 30697
176 Ga0453684_0009674 3300044712 Bacteria 16788
177 Ga0453684_0030161 3300044712 Bacteria 7669
178 Ga0453684_0070840 3300044712 Bacteria 4412
179 Ga0453684_0204213 3300044712 Bacteria 2301
180 Ga0453684_0380841 3300044712 Bacteria 1584
181 Ga0453684_0392927 3300044712 Unclassified 1555
182 Ga0453684_0406543 3300044712 Bacteria 1523
183 Ga0453684_0712648 3300044712 Bacteria 1089
184 Ga0451576_0188695 3300045051 Unclassified 2153
185 Ga0451576_0196890 3300045051 Bacteria 2105
186 Ga0495598_0008191 3300046537 Bacteria 2425
187 Ga0495669_0046602 3300046684 Bacteria 1935
188 Ga0496102_0320117 3300048905 Unclassified 1461
189 Ga0496104_0521591 3300048907 Unclassified 1099
190 Ga0496106_0441121 3300048909 Bacteria 1046
191 Ga0496115_0009110 3300048918 Bacteria 7367
192 Ga0501032_0017514 3300049569 Bacteria 5029
193 Ga0501034_0045925 3300049571 Bacteria 4413
194 Ga0501037_0021506 3300049573 Bacteria 4769
195 Ga0501046_0010181 3300049580 Bacteria 8091
196 Ga0501079_0297615 3300049741 Bacteria 1262
197 nmdc:mga05p37_228981_c1 3300050507 Unclassified 2240
198 nmdc:mga06r32_6292_c1 3300050510 Bacteria 10662
199 nmdc:mga08y16_43801_c1 3300050511 Bacteria 4690
200 nmdc:mga08y16_655702_c1 3300050511 Bacteria 1053
201 nmdc:mga0n895_215788_c1 3300050512 Bacteria 1948
202 nmdc:mga0a205_28504_c1 3300050515 Bacteria 5340
203 nmdc:mga0a205_486532_c1 3300050515 Unclassified 1092
204 2643894331 2643221577 Bacteria 3710843
205 2644476535 2643221685 Bacteria 3673288
206 Ga0316582_0151103
207 Ga0065704_10149951
208 Ga0065715_10123868
209 Ga0065715_10178675
210 Ga0065707_10103691
211 Ga0070666_10034666
212 Ga0068868_100064358
213 Ga0070661_100091027
214 Ga0070673_100244161
215 Ga0070705_100242082
216 Ga0070694_100009450
217 Ga0070708_100009739
218 Ga0070706_100051879
219 Ga0070706_100053848
220 Ga0070706_100099408
221 Ga0070707_100053038
222 Ga0070707_100063461
223 Ga0070698_100043717
224 Ga0070699_100002149
225 Ga0070699_100003341
226 Ga0070699_100074693
227 Ga0070699_100125603
228 Ga0070697_100005806
229 Ga0070697_100085031
230 Ga0068853_100086780
231 Ga0070686_100083461
232 Ga0070665_100125690
233 Ga0070665_100439219
234 Ga0070704_100128238
235 Ga0068855_100046621
236 Ga0070664_100047770
237 Ga0068856_100036695
238 Ga0068856_100055792
239 Ga0070702_100237425
240 Ga0068859_100004781
241 Ga0068859_100015692
242 Ga0068859_100055902
243 Ga0068859_100384429
244 Ga0068864_100001562
245 Ga0068864_100105151
246 Ga0068864_100453821
247 Ga0068860_100019459
248 Ga0068860_100167556
249 Ga0068862_100052865
250 Ga0081539_10003478
251 Ga0097621_100005687
252 Ga0068871_100026949
253 Ga0075431_100002945
254 Ga0097620_100004781
255 Ga0097620_100015693
256 Ga0097620_100055902
257 Ga0097620_100384414
258 Ga0099794_10000677
259 Ga0105240_10005878
260 Ga0114129_10023937
261 Ga0105243_10000589
262 Ga0105242_10000219
263 Ga0105248_10001083
264 Ga0105248_10038455
265 Ga0105237_10114536
266 Ga0105238_10147214
267 Ga0105249_10251755
268 Ga0157369_10000970
269 Ga0157374_10089070
270 Ga0157378_10005709
271 Ga0157378_10187191
272 Ga0157378_10548366
273 Ga0163162_10003393
274 Ga0163162_10348179
275 Ga0157372_10031305
276 Ga0157375_10368192
277 Ga0163163_10001916
278 Ga0163163_10042554
279 Ga0157380_10036913
280 Ga0207680_10037384
281 Ga0207684_10001826
282 Ga0207684_10007049
283 Ga0207684_10044706
284 Ga0207695_10009484
285 Ga0207649_10076589
286 Ga0207646_10006923
287 Ga0207646_10152190
288 Ga0207694_10114386
289 Ga0207686_10000022
290 Ga0207709_10000056
291 Ga0207711_10231518
292 Ga0207661_10109674
293 Ga0207679_10153217
294 Ga0207679_10206674
295 Ga0207667_10016087
296 Ga0207651_10216907
297 Ga0207712_10065309
298 Ga0207639_10046481
299 Ga0207639_10091053
300 Ga0207702_10026235
301 Ga0207676_10016183
302 Ga0207676_10122048
303 Ga0207675_100003958
304 Ga0207683_10197285
305 Ga0209588_1005352
306 Ga0207428_10035017
307 Ga0268266_10448494
308 Ga0268264_10184021
309 Ga0268264_10350328
310 Ga0265338_10000561
311 Ga0265338_10015143
312 Ga0265325_10072669
313 Ga0265316_10003957
314 Ga0265316_10021320
315 Ga0265316_10065351
316 Ga0316575_10019935
317 Ga0316575_10023067
318 Ga0316579_10000211
319 Ga0316579_10000560
320 Ga0316579_10017331
321 Ga0316576_10003904
322 Ga0316576_10017035
323 Ga0316576_10026941
324 Ga0316576_10117315
325 Ga0316576_10141174
326 Ga0316578_10003574
327 Ga0316578_10022258
328 Ga0316577_10000096
329 Ga0316577_10051570
330 Ga0316577_10057949
331 Ga0316577_10090323
332 Ga0307409_100479096
333 Ga0316583_10015468
334 Ga0316585_10020338
335 Ga0316585_10026416
336 Ga0316585_10062465
337 Ga0316580_10020149
338 Ga0316574_0023963
339 Ga0373937_0253425
340 Ga0316582_0000338
341 Ga0316582_0001154
342 Ga0316582_0004090
343 Ga0316582_0008451
344 Ga0316582_0010755
345 Ga0316582_0134746
346 Ga0316582_0139115
347 Ga0316582_0173490
348 Ga0316582_0192630
349 Ga0316582_0193435
350 Ga0316582_0226844
351 Ga0316584_0000496
352 Ga0316584_0001679
353 Ga0316584_0004985
354 Ga0316584_0017359
355 Ga0316584_0048179
356 Ga0316584_0080592
357 Ga0316584_0349634
358 Ga0316581_0000224
359 Ga0316581_0012216
360 Ga0316581_0027015
361 Ga0316581_0029021
362 Ga0400484_36301
363 Ga0400490_37627
364 Ga0400486_25655
365 Ga0400483_153720
366 Ga0400483_229347
367 Ga0400483_289677
368 Ga0400489_00747
369 Ga0400489_21294
370 Ga0400489_36520
371 Ga0400489_94892
372 Ga0400487_07741
373 Ga0451577_0008642
374 Ga0451577_0183135
375 Ga0451577_0285270
376 Ga0451577_0297010
377 Ga0453684_0000267
378 Ga0453684_0000535
379 Ga0453684_0002604
380 Ga0453684_0004235
381 Ga0453684_0009674
382 Ga0453684_0030161
383 Ga0453684_0070840
384 Ga0453684_0204213
385 Ga0453684_0380841
386 Ga0453684_0392927
387 Ga0453684_0406543
388 Ga0453684_0712648
389 Ga0451576_0188695
390 Ga0451576_0196890
391 Ga0495598_0008191
392 Ga0495669_0046602
393 Ga0496102_0320117
394 Ga0496104_0521591
395 Ga0496106_0441121
396 Ga0496115_0009110
397 Ga0501032_0017514
398 Ga0501034_0045925
399 Ga0501037_0021506
400 Ga0501046_0010181
401 Ga0501079_0297615
402 nmdc:mga05p37_228981_c1
403 nmdc:mga06r32_6292_c1
404 nmdc:mga08y16_43801_c1
405 nmdc:mga08y16_655702_c1
406 nmdc:mga0n895_215788_c1
407 nmdc:mga0a205_28504_c1
408 nmdc:mga0a205_486532_c1
409 2643894331
410 2644476535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

295

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8777 2 314
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8736 1 315
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8693 3 298
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8664 2 315
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8635 3 298
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8833 2 314 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8736 1 315 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8688 2 314 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.862 2 83 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8555 1 222 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A7C5ZFP5-F1-model_v4 Aldo/keto reductase 0.9946 1 204 GO:0016491
AF-A0A847MFF2-F1-model_v4 Aldo/keto reductase 0.9912 1 151 GO:0016491
AF-X1MED2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9891 1 176
AF-A0A254QFD8-F1-model_v4 Aldo/keto reductase 0.9883 1 124 GO:0005829
GO:0016491
AF-A0A847MFF2-F1-model_v4 Aldo/keto reductase 0.9848 1 151 GO:0016491

Map