F314070

General Info

Members Datasets Scaffolds Average Seq Length
205 131 410 206

Family's Representative Sequence

Representative Sequence 3300035085|Ga0373929_0008017|Ga0373929_0008017_1182_1925
Length 247
Sequence MAERGESDPEVQAARKMAAAVARKRKFISRRVTRGSIAVRGYHSGVETPSFPKRDPAGAEFWDLRYAADFAPWDAGRVPGQLREFVSAASRPRSVLVPGCGSAWDVRFLAESGWKVVGIDFSHEALGAARKILGPHVNSVRYGDFFARIPEAPFEVVYERAFLCALPRRMWSDWGKRMAEVVQPGGTLAGFFYFDAGDRGPPFPLHAPYELSELLEPAFKRVDDEPVPDSIEVFKDKERWQIWRRVD

Samples

Sample ID Description Type Environment
1 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 1.95
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 8.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373929_0008017 3300035085 Bacteria 1942
2 Ga0070658_10018456 3300005327 Bacteria 5585
3 Ga0070658_10112167 3300005327 Bacteria 2260
4 Ga0070658_10482071 3300005327 Bacteria 1070
5 Ga0070690_100084583 3300005330 Bacteria 2080
6 Ga0070680_100310434 3300005336 Bacteria 1338
7 Ga0070660_100265282 3300005339 Unclassified 1403
8 Ga0070689_100024323 3300005340 Bacteria 4542
9 Ga0070689_100065277 3300005340 Bacteria 2834
10 Ga0070689_100147792 3300005340 Unclassified 1894
11 Ga0070661_100179728 3300005344 Bacteria 1609
12 Ga0070661_100234135 3300005344 Bacteria 1412
13 Ga0070692_10082076 3300005345 Bacteria 1738
14 Ga0070671_100962075 3300005355 Bacteria 747
15 Ga0070673_100257393 3300005364 Bacteria 1523
16 Ga0070688_100079188 3300005365 Bacteria 2122
17 Ga0070659_100035302 3300005366 Bacteria 3894
18 Ga0070659_100060290 3300005366 Bacteria 2997
19 Ga0070714_100055250 3300005435 Bacteria 3393
20 Ga0070700_100120735 3300005441 Bacteria 1756
21 Ga0070678_100217117 3300005456 Bacteria 1588
22 Ga0070681_10029801 3300005458 Bacteria 5477
23 Ga0070681_10184478 3300005458 Bacteria 2007
24 Ga0068867_100032974 3300005459 Bacteria 3747
25 Ga0068867_100046295 3300005459 Bacteria 3194
26 Ga0070707_100241468 3300005468 Bacteria 1758
27 Ga0070699_100056071 3300005518 Bacteria 3412
28 Ga0070679_100060397 3300005530 Bacteria 3777
29 Ga0070679_100147039 3300005530 Bacteria 2334
30 Ga0070684_100155993 3300005535 Bacteria 2070
31 Ga0068853_100155123 3300005539 Bacteria 2063
32 Ga0068853_100903720 3300005539 Bacteria 848
33 Ga0070696_100007677 3300005546 Bacteria 7208
34 Ga0070693_100005781 3300005547 Bacteria 5978
35 Ga0070693_100072672 3300005547 Bacteria 2029
36 Ga0070665_100227051 3300005548 Bacteria 1867
37 Ga0070665_100610176 3300005548 Bacteria 1104
38 Ga0068855_100005825 3300005563 Bacteria 15039
39 Ga0068855_100009622 3300005563 Bacteria 11661
40 Ga0068855_100010857 3300005563 Bacteria 10996
41 Ga0068855_100023914 3300005563 Bacteria 7316
42 Ga0068855_100057841 3300005563 Bacteria 4544
43 Ga0068855_100474686 3300005563 Bacteria 1362
44 Ga0070664_100181197 3300005564 Bacteria 1872
45 Ga0068856_100127779 3300005614 Bacteria 2545
46 Ga0068852_100060931 3300005616 Bacteria 3277
47 Ga0068863_100323552 3300005841 Bacteria 1498
48 Ga0068863_100790921 3300005841 Bacteria 946
49 Ga0068858_100017821 3300005842 Bacteria 6649
50 Ga0068858_100025874 3300005842 Bacteria 5457
51 Ga0081539_10091273 3300005985 Unclassified 1574
52 Ga0081539_10132136 3300005985 Bacteria 1224
53 Ga0070712_100054682 3300006175 Bacteria 2792
54 Ga0075367_10091705 3300006178 Bacteria 1849
55 Ga0075366_10000623 3300006195 Bacteria 16637
56 Ga0097621_100036674 3300006237 Bacteria 3923
57 Ga0097621_100115023 3300006237 Bacteria 2277
58 Ga0097621_100146995 3300006237 Bacteria 2019
59 Ga0075370_10019195 3300006353 Bacteria 3720
60 Ga0068871_100031171 3300006358 Bacteria 4203
61 Ga0068871_100075694 3300006358 Bacteria 2779
62 Ga0075428_100025954 3300006844 Bacteria 6488
63 Ga0075434_100067322 3300006871 Bacteria 3568
64 Ga0068865_100193401 3300006881 Bacteria 1575
65 Ga0075436_100004628 3300006914 Bacteria 9426
66 Ga0105240_10016345 3300009093 Bacteria 10050
67 Ga0105240_10019836 3300009093 Bacteria 8979
68 Ga0105240_10060278 3300009093 Bacteria 4731
69 Ga0111539_10000221 3300009094 Bacteria 68470
70 Ga0105245_10015461 3300009098 Bacteria 6653
71 Ga0105245_10329114 3300009098 Unclassified 1507
72 Ga0105245_10376053 3300009098 Bacteria 1414
73 Ga0105245_10417016 3300009098 Bacteria 1345
74 Ga0105243_10233801 3300009148 Bacteria 1632
75 Ga0105241_10003057 3300009174 Bacteria 12476
76 Ga0105242_10000549 3300009176 Bacteria 29738
77 Ga0105242_10004900 3300009176 Bacteria 10363
78 Ga0105242_10079933 3300009176 Bacteria 2731
79 Ga0105248_10077248 3300009177 Bacteria 3743
80 Ga0105248_10455730 3300009177 Unclassified 1441
81 Ga0105248_11063743 3300009177 Bacteria 914
82 Ga0105237_10547359 3300009545 Bacteria 1164
83 Ga0105237_11029770 3300009545 Bacteria 830
84 Ga0105238_10011266 3300009551 Bacteria 9000
85 Ga0105238_10095568 3300009551 Bacteria 2958
86 Ga0105238_10100592 3300009551 Bacteria 2874
87 Ga0105238_10258695 3300009551 Bacteria 1720
88 Ga0105238_10333704 3300009551 Bacteria 1503
89 Ga0157370_10003378 3300013104 Bacteria 18757
90 Ga0157370_10003958 3300013104 Bacteria 17243
91 Ga0157370_10092706 3300013104 Bacteria 2835
92 Ga0157370_10151822 3300013104 Bacteria 2155
93 Ga0157369_10000089 3300013105 Bacteria 127323
94 Ga0157369_10001417 3300013105 Bacteria 29468
95 Ga0157369_10874947 3300013105 Bacteria 922
96 Ga0157369_11447054 3300013105 Bacteria 699
97 Ga0157378_10061061 3300013297 Bacteria 3363
98 Ga0157378_10080061 3300013297 Bacteria 2951
99 Ga0157378_10358385 3300013297 Bacteria 1427
100 Ga0163162_10162244 3300013306 Bacteria 2357
101 Ga0157372_10015941 3300013307 Bacteria 8059
102 Ga0157372_10041796 3300013307 Bacteria 5069
103 Ga0157372_10514704 3300013307 Bacteria 1395
104 Ga0157375_10026518 3300013308 Bacteria 5402
105 Ga0157380_10044512 3300014326 Bacteria 3479
106 Ga0157380_10449768 3300014326 Unclassified 1237
107 Ga0157379_10113633 3300014968 Bacteria 2434
108 Ga0157379_10178161 3300014968 Bacteria 1920
109 Ga0157376_10062211 3300014969 Bacteria 3140
110 Ga0157376_10306345 3300014969 Bacteria 1505
111 Ga0206356_10664795 3300020070 Bacteria 1980
112 Ga0206354_10471328 3300020081 Bacteria 1947
113 Ga0206353_10024797 3300020082 Bacteria 2601
114 Ga0224712_10000015 3300022467 Bacteria 25746
115 Ga0207699_10063078 3300025906 Bacteria 2237
116 Ga0207643_10055997 3300025908 Bacteria 2242
117 Ga0207705_10000300 3300025909 Bacteria 46048
118 Ga0207705_10088654 3300025909 Bacteria 2263
119 Ga0207705_10161182 3300025909 Bacteria 1685
120 Ga0207705_10311164 3300025909 Bacteria 1209
121 Ga0207695_10018944 3300025913 Bacteria 7941
122 Ga0207671_10216189 3300025914 Bacteria 1500
123 Ga0207657_10206794 3300025919 Unclassified 1577
124 Ga0207649_10205301 3300025920 Bacteria 1394
125 Ga0207649_10409674 3300025920 Bacteria 1016
126 Ga0207652_10149553 3300025921 Bacteria 2090
127 Ga0207694_10059620 3300025924 Bacteria 2969
128 Ga0207694_10576400 3300025924 Bacteria 946
129 Ga0207700_10111948 3300025928 Bacteria 2198
130 Ga0207644_10722548 3300025931 Bacteria 831
131 Ga0207690_10044674 3300025932 Bacteria 2922
132 Ga0207686_10003278 3300025934 Bacteria 8700
133 Ga0207709_10139930 3300025935 Bacteria 1662
134 Ga0207691_10190909 3300025940 Bacteria 1786
135 Ga0207689_10117521 3300025942 Unclassified 2186
136 Ga0207661_10270531 3300025944 Bacteria 1516
137 Ga0207661_10402844 3300025944 Unclassified 1241
138 Ga0207661_10639244 3300025944 Bacteria 978
139 Ga0207661_10856309 3300025944 Bacteria 837
140 Ga0207679_10336741 3300025945 Unclassified 1311
141 Ga0207667_10002848 3300025949 Bacteria 21464
142 Ga0207667_10004595 3300025949 Bacteria 16932
143 Ga0207667_10015898 3300025949 Bacteria 8521
144 Ga0207667_10037450 3300025949 Bacteria 5184
145 Ga0207667_10101642 3300025949 Bacteria 2966
146 Ga0207667_10400730 3300025949 Bacteria 1397
147 Ga0207639_10012937 3300026041 Bacteria 5821
148 Ga0207639_10079430 3300026041 Bacteria 2593
149 Ga0207708_10452760 3300026075 Bacteria 1069
150 Ga0207708_10580491 3300026075 Bacteria 948
151 Ga0207641_10652135 3300026088 Bacteria 1034
152 Ga0207648_10034097 3300026089 Bacteria 4489
153 Ga0207648_10068963 3300026089 Bacteria 3081
154 Ga0207683_10258363 3300026121 Bacteria 1590
155 Ga0207683_10533891 3300026121 Bacteria 1084
156 Ga0207428_10016033 3300027907 Bacteria 6457
157 Ga0307405_10280947 3300031731 Bacteria 1253
158 Ga0307412_10116166 3300031911 Unclassified 1919
159 Ga0307416_100048858 3300032002 Bacteria 3360
160 Ga0307416_100371159 3300032002 Bacteria 1457
161 Ga0373956_0053539 3300035119 Bacteria 1817
162 Ga0373933_0146625 3300035724 Bacteria 1493
163 Ga0373937_0012387 3300036401 Bacteria 7499
164 Ga0395900_0039125 3300037418 Bacteria 4887
165 Ga0395900_0242091 3300037418 Bacteria 1809
166 Ga0395898_0163897 3300037466 Bacteria 2126
167 Ga0395905_0029662 3300037471 Bacteria 5156
168 Ga0395901_0000059 3300038443 Bacteria 152667
169 Ga0395901_0042432 3300038443 Bacteria 4716
170 Ga0436365_1466900 3300039437 Unclassified 1104
171 Ga0439435_0088225 3300042436 Unclassified 939
172 Ga0451577_0289291 3300042876 Unclassified 1485
173 Ga0466957_0066645 3300044842 Bacteria 2220
174 Ga0466967_0664878 3300045976 Unclassified 1031
175 Ga0495651_0343729 3300046462 Bacteria 988
176 Ga0495608_0024245 3300046511 Bacteria 4150
177 Ga0495630_0422010 3300046517 Bacteria 1022
178 Ga0495587_0010382 3300046536 Bacteria 5930
179 Ga0495621_0018699 3300046539 Bacteria 2254
180 Ga0495645_0002795 3300046543 Bacteria 11841
181 Ga0495635_0632188 3300046663 Unclassified 697
182 Ga0495599_0007986 3300046678 Bacteria 6420
183 Ga0501047_0001630 3300049581 Bacteria 21895
184 Ga0501047_0315683 3300049581 Bacteria 1403
185 Ga0501069_0017575 3300049585 Bacteria 3852
186 Ga0501069_0512120 3300049585 Bacteria 716
187 Ga0501070_0000947 3300049586 Bacteria 26194
188 Ga0501072_0072064 3300049588 Bacteria 2730
189 Ga0501073_0001073 3300049589 Bacteria 19760
190 Ga0501074_0017850 3300049590 Bacteria 5155
191 Ga0501079_0005110 3300049741 Bacteria 9744
192 Ga0501080_0002422 3300049742 Bacteria 16280
193 Ga0501080_0111375 3300049742 Bacteria 2537
194 Ga0501083_0000323 3300049744 Bacteria 30331
195 Ga0501044_0061166 3300049823 Bacteria 3853
196 nmdc:mga0k408_5835_c1 3300050493 Bacteria 6559
197 nmdc:mga0k408_90737_c1 3300050493 Bacteria 1794
198 nmdc:mga08y16_3018_c1 3300050511 Bacteria 17375
199 nmdc:mga0n895_43523_c1 3300050512 Bacteria 4375
200 nmdc:mga08x19_2836_c1 3300050514 Bacteria 10453
201 Ga0495601_0010475 3300053077 Bacteria 5518
202 Ga0495619_0014955 3300053085 Bacteria 4902
203 Ga0501084_0058541 3300054114 Bacteria 3224
204 Ga0501082_0446868 3300060353 Unclassified 1129
205 2919477058 2919476304 Bacteria 5888696
206 Ga0373929_0008017
207 Ga0070658_10018456
208 Ga0070658_10112167
209 Ga0070658_10482071
210 Ga0070690_100084583
211 Ga0070680_100310434
212 Ga0070660_100265282
213 Ga0070689_100024323
214 Ga0070689_100065277
215 Ga0070689_100147792
216 Ga0070661_100179728
217 Ga0070661_100234135
218 Ga0070692_10082076
219 Ga0070671_100962075
220 Ga0070673_100257393
221 Ga0070688_100079188
222 Ga0070659_100035302
223 Ga0070659_100060290
224 Ga0070714_100055250
225 Ga0070700_100120735
226 Ga0070678_100217117
227 Ga0070681_10029801
228 Ga0070681_10184478
229 Ga0068867_100032974
230 Ga0068867_100046295
231 Ga0070707_100241468
232 Ga0070699_100056071
233 Ga0070679_100060397
234 Ga0070679_100147039
235 Ga0070684_100155993
236 Ga0068853_100155123
237 Ga0068853_100903720
238 Ga0070696_100007677
239 Ga0070693_100005781
240 Ga0070693_100072672
241 Ga0070665_100227051
242 Ga0070665_100610176
243 Ga0068855_100005825
244 Ga0068855_100009622
245 Ga0068855_100010857
246 Ga0068855_100023914
247 Ga0068855_100057841
248 Ga0068855_100474686
249 Ga0070664_100181197
250 Ga0068856_100127779
251 Ga0068852_100060931
252 Ga0068863_100323552
253 Ga0068863_100790921
254 Ga0068858_100017821
255 Ga0068858_100025874
256 Ga0081539_10091273
257 Ga0081539_10132136
258 Ga0070712_100054682
259 Ga0075367_10091705
260 Ga0075366_10000623
261 Ga0097621_100036674
262 Ga0097621_100115023
263 Ga0097621_100146995
264 Ga0075370_10019195
265 Ga0068871_100031171
266 Ga0068871_100075694
267 Ga0075428_100025954
268 Ga0075434_100067322
269 Ga0068865_100193401
270 Ga0075436_100004628
271 Ga0105240_10016345
272 Ga0105240_10019836
273 Ga0105240_10060278
274 Ga0111539_10000221
275 Ga0105245_10015461
276 Ga0105245_10329114
277 Ga0105245_10376053
278 Ga0105245_10417016
279 Ga0105243_10233801
280 Ga0105241_10003057
281 Ga0105242_10000549
282 Ga0105242_10004900
283 Ga0105242_10079933
284 Ga0105248_10077248
285 Ga0105248_10455730
286 Ga0105248_11063743
287 Ga0105237_10547359
288 Ga0105237_11029770
289 Ga0105238_10011266
290 Ga0105238_10095568
291 Ga0105238_10100592
292 Ga0105238_10258695
293 Ga0105238_10333704
294 Ga0157370_10003378
295 Ga0157370_10003958
296 Ga0157370_10092706
297 Ga0157370_10151822
298 Ga0157369_10000089
299 Ga0157369_10001417
300 Ga0157369_10874947
301 Ga0157369_11447054
302 Ga0157378_10061061
303 Ga0157378_10080061
304 Ga0157378_10358385
305 Ga0163162_10162244
306 Ga0157372_10015941
307 Ga0157372_10041796
308 Ga0157372_10514704
309 Ga0157375_10026518
310 Ga0157380_10044512
311 Ga0157380_10449768
312 Ga0157379_10113633
313 Ga0157379_10178161
314 Ga0157376_10062211
315 Ga0157376_10306345
316 Ga0206356_10664795
317 Ga0206354_10471328
318 Ga0206353_10024797
319 Ga0224712_10000015
320 Ga0207699_10063078
321 Ga0207643_10055997
322 Ga0207705_10000300
323 Ga0207705_10088654
324 Ga0207705_10161182
325 Ga0207705_10311164
326 Ga0207695_10018944
327 Ga0207671_10216189
328 Ga0207657_10206794
329 Ga0207649_10205301
330 Ga0207649_10409674
331 Ga0207652_10149553
332 Ga0207694_10059620
333 Ga0207694_10576400
334 Ga0207700_10111948
335 Ga0207644_10722548
336 Ga0207690_10044674
337 Ga0207686_10003278
338 Ga0207709_10139930
339 Ga0207691_10190909
340 Ga0207689_10117521
341 Ga0207661_10270531
342 Ga0207661_10402844
343 Ga0207661_10639244
344 Ga0207661_10856309
345 Ga0207679_10336741
346 Ga0207667_10002848
347 Ga0207667_10004595
348 Ga0207667_10015898
349 Ga0207667_10037450
350 Ga0207667_10101642
351 Ga0207667_10400730
352 Ga0207639_10012937
353 Ga0207639_10079430
354 Ga0207708_10452760
355 Ga0207708_10580491
356 Ga0207641_10652135
357 Ga0207648_10034097
358 Ga0207648_10068963
359 Ga0207683_10258363
360 Ga0207683_10533891
361 Ga0207428_10016033
362 Ga0307405_10280947
363 Ga0307412_10116166
364 Ga0307416_100048858
365 Ga0307416_100371159
366 Ga0373956_0053539
367 Ga0373933_0146625
368 Ga0373937_0012387
369 Ga0395900_0039125
370 Ga0395900_0242091
371 Ga0395898_0163897
372 Ga0395905_0029662
373 Ga0395901_0000059
374 Ga0395901_0042432
375 Ga0436365_1466900
376 Ga0439435_0088225
377 Ga0451577_0289291
378 Ga0466957_0066645
379 Ga0466967_0664878
380 Ga0495651_0343729
381 Ga0495608_0024245
382 Ga0495630_0422010
383 Ga0495587_0010382
384 Ga0495621_0018699
385 Ga0495645_0002795
386 Ga0495635_0632188
387 Ga0495599_0007986
388 Ga0501047_0001630
389 Ga0501047_0315683
390 Ga0501069_0017575
391 Ga0501069_0512120
392 Ga0501070_0000947
393 Ga0501072_0072064
394 Ga0501073_0001073
395 Ga0501074_0017850
396 Ga0501079_0005110
397 Ga0501080_0002422
398 Ga0501080_0111375
399 Ga0501083_0000323
400 Ga0501044_0061166
401 nmdc:mga0k408_5835_c1
402 nmdc:mga0k408_90737_c1
403 nmdc:mga08y16_3018_c1
404 nmdc:mga0n895_43523_c1
405 nmdc:mga08x19_2836_c1
406 Ga0495601_0010475
407 Ga0495619_0014955
408 Ga0501084_0058541
409 Ga0501082_0446868
410 2919477058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

96

190

0.91

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

57

245

0.89

PF08242

Methyltransf_12

Methyltransferase domain

96

188

0.87

PF13649

Methyltransf_25

Methyltransferase domain

95

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.9657 4 201
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.9563 4 201
3lcc-assembly1.cif.gz_A structure of a sam-dependent halide methyltransferase from arabidopsis thaliana 0.8937 15 202
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.8639 16 199
3lcc-assembly1.cif.gz_A structure of a sam-dependent halide methyltransferase from arabidopsis thaliana 0.8319 15 202
ID Description Score Start End Superfamily
af_B7E650_31_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8936 14 199 3.40.50.150
af_I6Y1G8_11_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8331 16 170 3.40.50.150
af_Q54QG2_134_419_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8316 35 178 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8314 25 181 3.40.50.150
af_O69687_132_410_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8296 36 179 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6M4GZC7-F1-model_v4 Thiopurine S-methyltransferase (EC 2.1.1.67) 0.9853 3 199 GO:0008119
GO:0032259
AF-A0A6J5DUQ2-F1-model_v4 Thiopurine S-methyltransferase (EC 2.1.1.67) 0.9817 2 202 GO:0008119
GO:0032259
AF-A0A845H1D8-F1-model_v4 SAM-dependent methyltransferase 0.9813 67 201 GO:0008757
GO:0032259
AF-A0A2N7WBA7-F1-model_v4 Thiopurine S-methyltransferase 0.9775 1 199 GO:0008757
GO:0032259
AF-A0A158EVH4-F1-model_v4 Thiopurine S-methyltransferase family protein 0.9772 2 199 GO:0008757
GO:0032259

Map