F313946

General Info

Members Datasets Scaffolds Average Seq Length
205 144 410 240

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10001356|Ga0207670_100013563
Length 270
Sequence VFLKEALSNRRDFGQVAELARPPQGPILIMSDWFSTLAAGSELPMDATSELQERGFVVIPGPTRPDLLANAYTSAVASATSDDIRIGSTSTKVNDFVNRGAEFDNLYVFPPLLEACYRVIGRPFKLSSLHARTLRPGSPSQELHVDVPRGSADWPLLGFILMVDEFRPNNGATRFVPGSHRWSSTPEDTISDLRAEHDGQMLACSNAGSLLIFNGSAWHGHTANTSSGPRRSLQGAFIPRAGRAGTDFAARMQPETRARLDSVAQYVLAL

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 5.37
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10001356 3300025936 Bacteria 12917
2 Ga0065712_10074450 3300005290 Bacteria 4079
3 Ga0065715_10004805 3300005293 Bacteria 4808
4 Ga0065707_10092175 3300005295 Bacteria 3814
5 Ga0070676_10058309 3300005328 Bacteria 2288
6 Ga0070683_100110118 3300005329 Bacteria 2597
7 Ga0068869_100009531 3300005334 Bacteria 6302
8 Ga0070682_100015370 3300005337 Bacteria 4433
9 Ga0070689_100049666 3300005340 Unclassified 3239
10 Ga0070689_100064930 3300005340 Bacteria 2842
11 Ga0070668_100189945 3300005347 Bacteria 1682
12 Ga0070669_100273373 3300005353 Bacteria 1352
13 Ga0070671_100113053 3300005355 Bacteria 2281
14 Ga0070671_100134122 3300005355 Bacteria 2087
15 Ga0070674_100005119 3300005356 Bacteria 7537
16 Ga0070673_100229302 3300005364 Bacteria 1611
17 Ga0070673_100360742 3300005364 Bacteria 1292
18 Ga0070673_100366914 3300005364 Bacteria 1281
19 Ga0070688_100056913 3300005365 Bacteria 2456
20 Ga0070688_100241387 3300005365 Bacteria 1282
21 Ga0070659_100328069 3300005366 Bacteria 1280
22 Ga0070667_100044041 3300005367 Bacteria 3746
23 Ga0070667_100298700 3300005367 Bacteria 1450
24 Ga0070701_10042652 3300005438 Bacteria 2317
25 Ga0070711_100015525 3300005439 Bacteria 4821
26 Ga0070700_100160349 3300005441 Bacteria 1548
27 Ga0070694_100055804 3300005444 Bacteria 2680
28 Ga0070694_100507210 3300005444 Unclassified 961
29 Ga0070678_100552178 3300005456 Bacteria 1023
30 Ga0070662_100003502 3300005457 Bacteria 9792
31 Ga0068867_100257285 3300005459 Bacteria 1422
32 Ga0068867_100328994 3300005459 Bacteria 1268
33 Ga0070685_10001437 3300005466 Bacteria 12492
34 Ga0070685_10004204 3300005466 Bacteria 7264
35 Ga0070685_10005020 3300005466 Bacteria 6704
36 Ga0070685_10353267 3300005466 Unclassified 1005
37 Ga0070706_100372063 3300005467 Bacteria 1331
38 Ga0070707_100223841 3300005468 Bacteria 1832
39 Ga0070698_100017570 3300005471 Bacteria 7538
40 Ga0070698_100451665 3300005471 Bacteria 1221
41 Ga0070699_100005198 3300005518 Bacteria 11443
42 Ga0068853_100281994 3300005539 Bacteria 1532
43 Ga0070672_100091093 3300005543 Bacteria 2460
44 Ga0070686_100117402 3300005544 Bacteria 1822
45 Ga0070696_100001846 3300005546 Bacteria 13916
46 Ga0070665_100000559 3300005548 Bacteria 51888
47 Ga0070665_100024318 3300005548 Bacteria 6100
48 Ga0070665_100112764 3300005548 Bacteria 2722
49 Ga0070664_100065149 3300005564 Bacteria 3108
50 Ga0070664_100131149 3300005564 Bacteria 2201
51 Ga0068857_100186191 3300005577 Bacteria 1890
52 Ga0068857_100613798 3300005577 Unclassified 1029
53 Ga0068854_100011507 3300005578 Bacteria 5764
54 Ga0070702_100155562 3300005615 Bacteria 1472
55 Ga0068859_100102748 3300005617 Bacteria 2916
56 Ga0068859_100150950 3300005617 Bacteria 2399
57 Ga0068859_100245800 3300005617 Unclassified 1879
58 Ga0068859_100310768 3300005617 Bacteria 1670
59 Ga0068864_100002899 3300005618 Bacteria 14178
60 Ga0068864_100014034 3300005618 Bacteria 6643
61 Ga0068866_10004153 3300005718 Bacteria 5940
62 Ga0068861_100065229 3300005719 Bacteria 2804
63 Ga0068870_10071367 3300005840 Bacteria 1895
64 Ga0068863_100095780 3300005841 Unclassified 2817
65 Ga0068858_100198479 3300005842 Bacteria 1897
66 Ga0068860_100121595 3300005843 Bacteria 2500
67 Ga0068860_100207391 3300005843 Bacteria 1901
68 Ga0068862_100049936 3300005844 Bacteria 3574
69 Ga0070712_100017906 3300006175 Bacteria 4590
70 Ga0097621_100147586 3300006237 Bacteria 2015
71 Ga0097621_100198662 3300006237 Bacteria 1740
72 Ga0068871_100091020 3300006358 Bacteria 2542
73 Ga0068871_100344909 3300006358 Bacteria 1316
74 Ga0068871_100511182 3300006358 Bacteria 1084
75 Ga0075428_100056036 3300006844 Unclassified 4318
76 Ga0075428_100641731 3300006844 Bacteria 1133
77 Ga0075428_100746213 3300006844 Bacteria 1041
78 Ga0075433_10762370 3300006852 Bacteria 846
79 Ga0075434_100937561 3300006871 Unclassified 880
80 Ga0075429_100221881 3300006880 Bacteria 1656
81 Ga0068865_100108141 3300006881 Bacteria 2046
82 Ga0097620_100102751 3300006931 Bacteria 2916
83 Ga0097620_100150952 3300006931 Bacteria 2399
84 Ga0097620_100245825 3300006931 Unclassified 1879
85 Ga0097620_100310767 3300006931 Bacteria 1670
86 Ga0075435_100068024 3300007076 Unclassified 2901
87 Ga0111539_10333524 3300009094 Unclassified 1765
88 Ga0111539_10943219 3300009094 Bacteria 1003
89 Ga0114129_10391228 3300009147 Bacteria 1834
90 Ga0114129_10576422 3300009147 Bacteria 1461
91 Ga0105243_10319460 3300009148 Bacteria 1414
92 Ga0105242_10438265 3300009176 Unclassified 1229
93 Ga0105248_10047549 3300009177 Bacteria 4812
94 Ga0105248_10539059 3300009177 Bacteria 1316
95 Ga0105249_10068365 3300009553 Bacteria 3276
96 Ga0105239_10016083 3300010375 Bacteria 8277
97 Ga0105246_10167960 3300011119 Bacteria 1677
98 Ga0157374_10193762 3300013296 Bacteria 1988
99 Ga0157374_10586616 3300013296 Bacteria 1124
100 Ga0157374_10703560 3300013296 Bacteria 1024
101 Ga0157374_10778426 3300013296 Unclassified 972
102 Ga0157378_10737219 3300013297 Bacteria 1007
103 Ga0163162_10081128 3300013306 Bacteria 3314
104 Ga0163162_11093685 3300013306 Bacteria 903
105 Ga0157375_10204299 3300013308 Bacteria 2132
106 Ga0157375_10945628 3300013308 Bacteria 1004
107 Ga0163163_10003159 3300014325 Bacteria 13956
108 Ga0163163_10184248 3300014325 Bacteria 2135
109 Ga0163163_10328441 3300014325 Unclassified 1583
110 Ga0157380_10514164 3300014326 Bacteria 1166
111 Ga0157376_10160962 3300014969 Bacteria 2035
112 Ga0163161_10178973 3300017792 Bacteria 1625
113 Ga0213876_10018108 3300021384 Unclassified 3717
114 Ga0213876_10034132 3300021384 Bacteria 2683
115 Ga0207645_10001074 3300025907 Bacteria 22585
116 Ga0207645_10033880 3300025907 Bacteria 3282
117 Ga0207654_10083295 3300025911 Bacteria 1931
118 Ga0207693_10036898 3300025915 Bacteria 3854
119 Ga0207663_10009721 3300025916 Bacteria 5091
120 Ga0207663_10473080 3300025916 Unclassified 970
121 Ga0207662_10542548 3300025918 Bacteria 805
122 Ga0207659_10079114 3300025926 Bacteria 2425
123 Ga0207659_10160871 3300025926 Bacteria 1763
124 Ga0207687_10176436 3300025927 Bacteria 1652
125 Ga0207644_10169302 3300025931 Bacteria 1704
126 Ga0207706_10001874 3300025933 Bacteria 20609
127 Ga0207706_10216327 3300025933 Bacteria 1678
128 Ga0207709_10312634 3300025935 Bacteria 1173
129 Ga0207669_10045784 3300025937 Bacteria 2580
130 Ga0207704_10081093 3300025938 Bacteria 2097
131 Ga0207691_10082091 3300025940 Bacteria 2896
132 Ga0207691_10188546 3300025940 Bacteria 1800
133 Ga0207691_10525408 3300025940 Bacteria 1004
134 Ga0207711_10105333 3300025941 Bacteria 2501
135 Ga0207689_10001812 3300025942 Bacteria 20170
136 Ga0207689_10024109 3300025942 Bacteria 5105
137 Ga0207689_10188185 3300025942 Bacteria 1703
138 Ga0207689_10201017 3300025942 Bacteria 1645
139 Ga0207689_10456351 3300025942 Unclassified 1068
140 Ga0207661_10169808 3300025944 Bacteria 1898
141 Ga0207679_10483613 3300025945 Bacteria 1102
142 Ga0207651_10389054 3300025960 Unclassified 1184
143 Ga0207651_10602945 3300025960 Bacteria 960
144 Ga0207668_10505498 3300025972 Bacteria 1040
145 Ga0207640_10321312 3300025981 Unclassified 1232
146 Ga0207703_10652869 3300026035 Bacteria 998
147 Ga0207708_10047669 3300026075 Bacteria 3261
148 Ga0207708_10621055 3300026075 Unclassified 917
149 Ga0207641_10052900 3300026088 Unclassified 3440
150 Ga0207641_10271831 3300026088 Bacteria 1590
151 Ga0207648_10143974 3300026089 Bacteria 2102
152 Ga0207676_10046959 3300026095 Bacteria 3344
153 Ga0207675_100005273 3300026118 Bacteria 12434
154 Ga0207683_10530186 3300026121 Bacteria 1088
155 Ga0268266_10001662 3300028379 Bacteria 25676
156 Ga0268266_10058666 3300028379 Bacteria 3314
157 Ga0268265_10125370 3300028380 Bacteria 2124
158 Ga0265337_1000100 3300028556 Bacteria 42320
159 Ga0265336_10020838 3300028666 Bacteria 2100
160 Ga0265338_10003626 3300028800 Bacteria 21506
161 Ga0265328_10110044 3300031239 Bacteria 1024
162 Ga0265320_10142569 3300031240 Bacteria 1084
163 Ga0373931_0468754 3300035691 Unclassified 808
164 Ga0373935_0733000 3300035692 Viruses 728
165 Ga0395900_0161631 3300037418 Unclassified 2284
166 Ga0436365_0119232 3300039437 Bacteria 7631
167 Ga0436365_1303277 3300039437 Bacteria 6064
168 Ga0439456_026670 3300042013 Bacteria 1229
169 Ga0451576_0320760 3300045051 Bacteria 1621
170 Ga0451576_0707118 3300045051 Unclassified 1059
171 Ga0451576_1162500 3300045051 Unclassified 806
172 Ga0495582_0092790 3300046473 Bacteria 1685
173 Ga0495630_0270399 3300046517 Unclassified 1298
174 Ga0495652_0432612 3300046529 Unclassified 925
175 Ga0495598_0057719 3300046537 Unclassified 1189
176 Ga0495658_0299949 3300046683 Bacteria 1016
177 Ga0495669_0285125 3300046684 Unclassified 795
178 Ga0496102_0246417 3300048905 Bacteria 1685
179 Ga0496104_0189963 3300048907 Bacteria 1965
180 Ga0496105_0048302 3300048908 Bacteria 3513
181 Ga0496105_0200755 3300048908 Bacteria 1628
182 Ga0496106_0052630 3300048909 Bacteria 3073
183 Ga0496106_0495784 3300048909 Bacteria 981
184 Ga0496108_0011378 3300048911 Bacteria 7232
185 Ga0496108_0649038 3300048911 Bacteria 917
186 Ga0496110_0132632 3300048913 Bacteria 2250
187 Ga0496112_0001717 3300048915 Bacteria 17117
188 Ga0496113_0047618 3300048916 Bacteria 3186
189 Ga0501033_0242031 3300049570 Bacteria 1280
190 Ga0501036_0169349 3300049572 Bacteria 1840
191 Ga0501040_0075736 3300049576 Bacteria 2326
192 Ga0501072_0064948 3300049588 Unclassified 2878
193 Ga0501075_0047238 3300049591 Bacteria 3235
194 Ga0501076_0173930 3300049592 Unclassified 1755
195 Ga0501080_0340545 3300049742 Unclassified 1355
196 Ga0501045_0037078 3300049824 Unclassified 3543
197 nmdc:mga03n38_197906_c1 3300050490 Bacteria 1038
198 nmdc:mga05p37_364694_c1 3300050507 Bacteria 1697
199 nmdc:mga05p37_566786_c1 3300050507 Bacteria 1289
200 nmdc:mga08y16_253620_c1 3300050511 Bacteria 1818
201 nmdc:mga0n895_344853_c1 3300050512 Bacteria 1508
202 nmdc:mga0rr50_7838_c1 3300050513 Bacteria 6619
203 nmdc:mga0a205_13507_c1 3300050515 Bacteria 7036
204 Ga0501084_0231946 3300054114 Unclassified 1558
205 Ga0530510_0006654 3300061734 Bacteria 8061
206 Ga0207670_10001356
207 Ga0065712_10074450
208 Ga0065715_10004805
209 Ga0065707_10092175
210 Ga0070676_10058309
211 Ga0070683_100110118
212 Ga0068869_100009531
213 Ga0070682_100015370
214 Ga0070689_100049666
215 Ga0070689_100064930
216 Ga0070668_100189945
217 Ga0070669_100273373
218 Ga0070671_100113053
219 Ga0070671_100134122
220 Ga0070674_100005119
221 Ga0070673_100229302
222 Ga0070673_100360742
223 Ga0070673_100366914
224 Ga0070688_100056913
225 Ga0070688_100241387
226 Ga0070659_100328069
227 Ga0070667_100044041
228 Ga0070667_100298700
229 Ga0070701_10042652
230 Ga0070711_100015525
231 Ga0070700_100160349
232 Ga0070694_100055804
233 Ga0070694_100507210
234 Ga0070678_100552178
235 Ga0070662_100003502
236 Ga0068867_100257285
237 Ga0068867_100328994
238 Ga0070685_10001437
239 Ga0070685_10004204
240 Ga0070685_10005020
241 Ga0070685_10353267
242 Ga0070706_100372063
243 Ga0070707_100223841
244 Ga0070698_100017570
245 Ga0070698_100451665
246 Ga0070699_100005198
247 Ga0068853_100281994
248 Ga0070672_100091093
249 Ga0070686_100117402
250 Ga0070696_100001846
251 Ga0070665_100000559
252 Ga0070665_100024318
253 Ga0070665_100112764
254 Ga0070664_100065149
255 Ga0070664_100131149
256 Ga0068857_100186191
257 Ga0068857_100613798
258 Ga0068854_100011507
259 Ga0070702_100155562
260 Ga0068859_100102748
261 Ga0068859_100150950
262 Ga0068859_100245800
263 Ga0068859_100310768
264 Ga0068864_100002899
265 Ga0068864_100014034
266 Ga0068866_10004153
267 Ga0068861_100065229
268 Ga0068870_10071367
269 Ga0068863_100095780
270 Ga0068858_100198479
271 Ga0068860_100121595
272 Ga0068860_100207391
273 Ga0068862_100049936
274 Ga0070712_100017906
275 Ga0097621_100147586
276 Ga0097621_100198662
277 Ga0068871_100091020
278 Ga0068871_100344909
279 Ga0068871_100511182
280 Ga0075428_100056036
281 Ga0075428_100641731
282 Ga0075428_100746213
283 Ga0075433_10762370
284 Ga0075434_100937561
285 Ga0075429_100221881
286 Ga0068865_100108141
287 Ga0097620_100102751
288 Ga0097620_100150952
289 Ga0097620_100245825
290 Ga0097620_100310767
291 Ga0075435_100068024
292 Ga0111539_10333524
293 Ga0111539_10943219
294 Ga0114129_10391228
295 Ga0114129_10576422
296 Ga0105243_10319460
297 Ga0105242_10438265
298 Ga0105248_10047549
299 Ga0105248_10539059
300 Ga0105249_10068365
301 Ga0105239_10016083
302 Ga0105246_10167960
303 Ga0157374_10193762
304 Ga0157374_10586616
305 Ga0157374_10703560
306 Ga0157374_10778426
307 Ga0157378_10737219
308 Ga0163162_10081128
309 Ga0163162_11093685
310 Ga0157375_10204299
311 Ga0157375_10945628
312 Ga0163163_10003159
313 Ga0163163_10184248
314 Ga0163163_10328441
315 Ga0157380_10514164
316 Ga0157376_10160962
317 Ga0163161_10178973
318 Ga0213876_10018108
319 Ga0213876_10034132
320 Ga0207645_10001074
321 Ga0207645_10033880
322 Ga0207654_10083295
323 Ga0207693_10036898
324 Ga0207663_10009721
325 Ga0207663_10473080
326 Ga0207662_10542548
327 Ga0207659_10079114
328 Ga0207659_10160871
329 Ga0207687_10176436
330 Ga0207644_10169302
331 Ga0207706_10001874
332 Ga0207706_10216327
333 Ga0207709_10312634
334 Ga0207669_10045784
335 Ga0207704_10081093
336 Ga0207691_10082091
337 Ga0207691_10188546
338 Ga0207691_10525408
339 Ga0207711_10105333
340 Ga0207689_10001812
341 Ga0207689_10024109
342 Ga0207689_10188185
343 Ga0207689_10201017
344 Ga0207689_10456351
345 Ga0207661_10169808
346 Ga0207679_10483613
347 Ga0207651_10389054
348 Ga0207651_10602945
349 Ga0207668_10505498
350 Ga0207640_10321312
351 Ga0207703_10652869
352 Ga0207708_10047669
353 Ga0207708_10621055
354 Ga0207641_10052900
355 Ga0207641_10271831
356 Ga0207648_10143974
357 Ga0207676_10046959
358 Ga0207675_100005273
359 Ga0207683_10530186
360 Ga0268266_10001662
361 Ga0268266_10058666
362 Ga0268265_10125370
363 Ga0265337_1000100
364 Ga0265336_10020838
365 Ga0265338_10003626
366 Ga0265328_10110044
367 Ga0265320_10142569
368 Ga0373931_0468754
369 Ga0373935_0733000
370 Ga0395900_0161631
371 Ga0436365_0119232
372 Ga0436365_1303277
373 Ga0439456_026670
374 Ga0451576_0320760
375 Ga0451576_0707118
376 Ga0451576_1162500
377 Ga0495582_0092790
378 Ga0495630_0270399
379 Ga0495652_0432612
380 Ga0495598_0057719
381 Ga0495658_0299949
382 Ga0495669_0285125
383 Ga0496102_0246417
384 Ga0496104_0189963
385 Ga0496105_0048302
386 Ga0496105_0200755
387 Ga0496106_0052630
388 Ga0496106_0495784
389 Ga0496108_0011378
390 Ga0496108_0649038
391 Ga0496110_0132632
392 Ga0496112_0001717
393 Ga0496113_0047618
394 Ga0501033_0242031
395 Ga0501036_0169349
396 Ga0501040_0075736
397 Ga0501072_0064948
398 Ga0501075_0047238
399 Ga0501076_0173930
400 Ga0501080_0340545
401 Ga0501045_0037078
402 nmdc:mga03n38_197906_c1
403 nmdc:mga05p37_364694_c1
404 nmdc:mga05p37_566786_c1
405 nmdc:mga08y16_253620_c1
406 nmdc:mga0n895_344853_c1
407 nmdc:mga0rr50_7838_c1
408 nmdc:mga0a205_13507_c1
409 Ga0501084_0231946
410 Ga0530510_0006654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

51

232

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7de0-assembly1.cif.gz_C crystal structure of ftmox1 y224f mutation 0.8433 2 214
7eyw-assembly2.cif.gz_D-3 fe(ii)/(alpha)ketoglutarate-dependent dioxygenase sptf with terretonin c 0.8433 40 214
6oxj-assembly1.cif.gz_B x-ray crystal structure of y140f ftmox1 bound to fe(ii) 0.8405 2 214
7etl-assembly1.cif.gz_B the crystal structure of ftmox1-y68f 0.8351 2 214
6oxj-assembly1.cif.gz_A x-ray crystal structure of y140f ftmox1 bound to fe(ii) 0.835 2 214
ID Description Score Start End Superfamily
4zonA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8446 2 214 2.60.120.620
af_P9WI89_1_263_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8336 2 214 2.60.120.620
4zonA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8301 2 214 2.60.120.620
af_P9WI89_1_263_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8192 2 214 2.60.120.620
5y7tB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8184 3 215 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A6L8E4E2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9909 2 214 GO:0051213
AF-A0A7Y4RU72-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9892 2 216 GO:0005506
GO:0016706
AF-A0A7Y4RU72-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9802 2 216 GO:0005506
GO:0016706
AF-A0A6L8E4E2-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9727 2 214 GO:0051213
AF-A0A378F6V1-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9681 104 215 GO:0051213

Map