F313856

General Info

Members Datasets Scaffolds Average Seq Length
205 125 205 402

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10040407|Ga0157375_100404074
Length 433
Sequence MDMGKQSLRSCSELIVQRRIMKIRTALGFVLILFFYSQLAAQNSDWPQWRGPNRDGVSKETGLLKQWPAEGPPLVWKAVGAGTGYSSLAIAGGRIYTMGVRGEREYVIAFDVATGKELWATAGGNRYKDDRGDGPRGTPTVDGDRLYALGGNGDLSCIDTKTGRIVWAMNVLQKFGGSNPNWGISESPLVIGEKLLVNAGGPDASIIALNKKDGTLIWKSQSDEAGYSSAMPVQVGSTTQVVFFTSRRAVAVDARDGRLLWEYLKASNRTANVATPVIRGNRVFISSDYGTGAGLVEIKSDGTAQEVYFTREMRNHHSSSILIGDYLYGFSSGVLTAMKFDTGEVAWKDRSVGKGSLVYADGYLYAFSENGVVGLIEATPTGYLEKGRFRIQQDSLPTWTHPVIAGGRLYIRDQNTIYAYDVKAKKGAGDKSD

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10069287 3300005290 Bacteria 7588
2 Ga0065707_10086558 3300005295 Bacteria 5402
3 Ga0065707_10180254 3300005295 Unclassified 1423
4 Ga0070690_100007604 3300005330 Bacteria 6206
5 Ga0070690_100040517 3300005330 Bacteria 2946
6 Ga0068869_100140241 3300005334 Bacteria 1866
7 Ga0070680_100004103 3300005336 Bacteria 10909
8 Ga0070680_100037178 3300005336 Unclassified 3934
9 Ga0070682_100000059 3300005337 Bacteria 106643
10 Ga0070682_100099151 3300005337 Bacteria 1920
11 Ga0068868_100110289 3300005338 Bacteria 2235
12 Ga0068868_100278632 3300005338 Unclassified 1415
13 Ga0070660_100164354 3300005339 Bacteria 1790
14 Ga0070689_100183344 3300005340 Unclassified 1701
15 Ga0070687_100003799 3300005343 Bacteria 5928
16 Ga0070692_10005924 3300005345 Bacteria 5264
17 Ga0070669_100008642 3300005353 Bacteria 7265
18 Ga0070669_100052872 3300005353 Bacteria 2973
19 Ga0070669_100169504 3300005353 Bacteria 1701
20 Ga0070671_100175237 3300005355 Bacteria 1814
21 Ga0070674_100072966 3300005356 Bacteria 2432
22 Ga0070673_100004575 3300005364 Bacteria 8770
23 Ga0070659_100050353 3300005366 Bacteria 3274
24 Ga0070659_100235618 3300005366 Bacteria 1513
25 Ga0070700_100007106 3300005441 Bacteria 6022
26 Ga0070700_100089581 3300005441 Bacteria 2005
27 Ga0070694_100032727 3300005444 Bacteria 3416
28 Ga0070694_100069048 3300005444 Bacteria 2430
29 Ga0070708_100319448 3300005445 Unclassified 1463
30 Ga0070678_100195270 3300005456 Bacteria 1667
31 Ga0070662_100226991 3300005457 Unclassified 1492
32 Ga0070681_10000254 3300005458 Bacteria 42307
33 Ga0070681_10010312 3300005458 Bacteria 9223
34 Ga0068867_100071488 3300005459 Unclassified 2595
35 Ga0070685_10026619 3300005466 Bacteria 3188
36 Ga0070698_100004385 3300005471 Bacteria 15500
37 Ga0070698_100008280 3300005471 Bacteria 11242
38 Ga0070698_100018133 3300005471 Bacteria 7409
39 Ga0070698_100202725 3300005471 Unclassified 1919
40 Ga0070679_100000029 3300005530 Bacteria 108401
41 Ga0070697_100000018 3300005536 Bacteria 140702
42 Ga0068853_100019200 3300005539 Bacteria 5665
43 Ga0070672_100270581 3300005543 Unclassified 1434
44 Ga0070686_100005534 3300005544 Bacteria 6989
45 Ga0070686_100008042 3300005544 Bacteria 5891
46 Ga0070686_100040045 3300005544 Bacteria 2923
47 Ga0070696_100120916 3300005546 Bacteria 1895
48 Ga0070704_100009403 3300005549 Bacteria 5902
49 Ga0070704_100094066 3300005549 Unclassified 2241
50 Ga0070704_100141486 3300005549 Bacteria 1879
51 Ga0070704_100158658 3300005549 Unclassified 1787
52 Ga0070664_100001444 3300005564 Bacteria 18958
53 Ga0068854_100076502 3300005578 Unclassified 2460
54 Ga0068856_100067135 3300005614 Bacteria 3544
55 Ga0068859_100035967 3300005617 Unclassified 4969
56 Ga0068859_100275141 3300005617 Bacteria 1776
57 Ga0068864_100047696 3300005618 Bacteria 3680
58 Ga0068866_10009045 3300005718 Unclassified 4220
59 Ga0068861_100018429 3300005719 Unclassified 4973
60 Ga0068861_100033870 3300005719 Unclassified 3772
61 Ga0068861_100088050 3300005719 Unclassified 2444
62 Ga0068863_100143068 3300005841 Unclassified 2287
63 Ga0068858_100083198 3300005842 Bacteria 2976
64 Ga0068858_100112626 3300005842 Bacteria 2541
65 Ga0068858_100122270 3300005842 Bacteria 2435
66 Ga0068862_100014136 3300005844 Bacteria 6619
67 Ga0081539_10046889 3300005985 Bacteria 2473
68 Ga0075367_10041384 3300006178 Unclassified 2693
69 Ga0097621_100002263 3300006237 Bacteria 13169
70 Ga0075428_100006533 3300006844 Bacteria 12965
71 Ga0075428_100014114 3300006844 Bacteria 8890
72 Ga0075428_100098029 3300006844 Bacteria 3196
73 Ga0075430_100026761 3300006846 Bacteria 4905
74 Ga0075430_100093533 3300006846 Bacteria 2513
75 Ga0075430_100231833 3300006846 Unclassified 1531
76 Ga0075431_100020142 3300006847 Bacteria 6812
77 Ga0075431_100079942 3300006847 Bacteria 3375
78 Ga0075431_100165047 3300006847 Bacteria 2276
79 Ga0075434_100055077 3300006871 Bacteria 3952
80 Ga0075434_100134326 3300006871 Bacteria 2494
81 Ga0075429_100034330 3300006880 Bacteria 4407
82 Ga0075429_100041993 3300006880 Bacteria 3980
83 Ga0075429_100291405 3300006880 Bacteria 1429
84 Ga0068865_100123837 3300006881 Bacteria 1927
85 Ga0097620_100035968 3300006931 Unclassified 4969
86 Ga0097620_100275144 3300006931 Bacteria 1776
87 Ga0075435_100017366 3300007076 Bacteria 5446
88 Ga0075435_100036832 3300007076 Bacteria 3891
89 Ga0075435_100327552 3300007076 Bacteria 1311
90 Ga0111539_10004336 3300009094 Bacteria 18565
91 Ga0111539_10008876 3300009094 Bacteria 12729
92 Ga0111539_10026016 3300009094 Bacteria 7162
93 Ga0111539_10106487 3300009094 Bacteria 3289
94 Ga0111539_10166251 3300009094 Unclassified 2579
95 Ga0105245_10257285 3300009098 Bacteria 1698
96 Ga0114129_10002249 3300009147 Bacteria 26666
97 Ga0114129_10024308 3300009147 Bacteria 8584
98 Ga0114129_10066973 3300009147 Bacteria 5008
99 Ga0105241_10013504 3300009174 Bacteria 5984
100 Ga0105242_10019976 3300009176 Bacteria 5248
101 Ga0105242_10046911 3300009176 Bacteria 3507
102 Ga0105242_10210987 3300009176 Unclassified 1731
103 Ga0105248_10044180 3300009177 Unclassified 4997
104 Ga0105249_10000201 3300009553 Bacteria 68199
105 Ga0157378_10014809 3300013297 Bacteria 6826
106 Ga0163162_10000128 3300013306 Bacteria 68199
107 Ga0163162_10038124 3300013306 Bacteria 4797
108 Ga0157375_10040407 3300013308 Unclassified 4496
109 Ga0163163_10028745 3300014325 Bacteria 5343
110 Ga0163163_10160299 3300014325 Bacteria 2295
111 Ga0157380_10000470 3300014326 Bacteria 24591
112 Ga0157380_10005208 3300014326 Bacteria 9088
113 Ga0157380_10098118 3300014326 Bacteria 2433
114 Ga0157380_10300625 3300014326 Bacteria 1478
115 Ga0157377_10062596 3300014745 Bacteria 2129
116 Ga0157376_10104476 3300014969 Bacteria 2482
117 Ga0163161_10016306 3300017792 Bacteria 5186
118 Ga0207647_10130351 3300025904 Bacteria 1478
119 Ga0207707_10000060 3300025912 Bacteria 108561
120 Ga0207707_10007805 3300025912 Bacteria 9312
121 Ga0207660_10013327 3300025917 Bacteria 5386
122 Ga0207652_10000073 3300025921 Bacteria 108588
123 Ga0207652_10041245 3300025921 Unclassified 3923
124 Ga0207646_10009236 3300025922 Bacteria 9765
125 Ga0207681_10013358 3300025923 Bacteria 5081
126 Ga0207681_10014725 3300025923 Unclassified 4869
127 Ga0207681_10110978 3300025923 Bacteria 1995
128 Ga0207644_10002223 3300025931 Bacteria 12594
129 Ga0207690_10087875 3300025932 Bacteria 2188
130 Ga0207690_10149911 3300025932 Bacteria 1728
131 Ga0207691_10002560 3300025940 Bacteria 17760
132 Ga0207689_10023652 3300025942 Bacteria 5152
133 Ga0207689_10028138 3300025942 Bacteria 4701
134 Ga0207689_10029494 3300025942 Bacteria 4581
135 Ga0207679_10101892 3300025945 Bacteria 2247
136 Ga0207712_10000330 3300025961 Bacteria 43368
137 Ga0207668_10007655 3300025972 Bacteria 6427
138 Ga0207703_10115469 3300026035 Unclassified 2297
139 Ga0207708_10001112 3300026075 Bacteria 20185
140 Ga0207708_10094807 3300026075 Bacteria 2304
141 Ga0207641_10074237 3300026088 Bacteria 2933
142 Ga0207641_10293351 3300026088 Bacteria 1534
143 Ga0207648_10143198 3300026089 Unclassified 2108
144 Ga0207676_10223498 3300026095 Bacteria 1678
145 Ga0207674_10000332 3300026116 Bacteria 60296
146 Ga0207675_100002007 3300026118 Bacteria 20297
147 Ga0207675_100004930 3300026118 Bacteria 12863
148 Ga0207675_100090975 3300026118 Unclassified 2869
149 Ga0207675_100236116 3300026118 Unclassified 1765
150 Ga0207683_10219416 3300026121 Unclassified 1732
151 Ga0207683_10266800 3300026121 Bacteria 1564
152 Ga0207428_10014381 3300027907 Bacteria 6880
153 Ga0268265_10033817 3300028380 Unclassified 3720
154 Ga0307408_100098816 3300031548 Bacteria 2220
155 Ga0307409_100032900 3300031995 Bacteria 3767
156 Ga0307409_100172973 3300031995 Bacteria 1903
157 Ga0373947_0022134 3300035725 Bacteria 3683
158 Ga0450923_000752 3300042125 Bacteria 3867
159 Ga0439434_0033752 3300042435 Unclassified 1561
160 Ga0439460_0017178 3300042461 Unclassified 1936
161 Ga0451576_0017912 3300045051 Bacteria 7777
162 Ga0495639_0141663 3300046475 Unclassified 1156
163 Ga0495674_0121850 3300047319 Unclassified 2203
164 Ga0496102_0058290 3300048905 Bacteria 3528
165 Ga0496112_0081618 3300048915 Bacteria 3198
166 Ga0501031_0123826 3300049568 Unclassified 1689
167 Ga0501031_0149679 3300049568 Bacteria 1525
168 Ga0501036_0054392 3300049572 Bacteria 3391
169 Ga0501036_0077676 3300049572 Unclassified 2809
170 Ga0501042_0040442 3300049578 Bacteria 3315
171 Ga0501042_0107165 3300049578 Bacteria 2012
172 Ga0501048_0081216 3300049582 Bacteria 2287
173 Ga0501070_0091684 3300049586 Bacteria 2515
174 Ga0501071_0088562 3300049587 Bacteria 2271
175 Ga0501072_0022715 3300049588 Bacteria 4867
176 Ga0501072_0084078 3300049588 Bacteria 2523
177 Ga0501072_0099126 3300049588 Bacteria 2316
178 Ga0501075_0021818 3300049591 Bacteria 4671
179 Ga0501076_0018771 3300049592 Bacteria 5277
180 Ga0501076_0232758 3300049592 Unclassified 1506
181 Ga0501077_0030566 3300049593 Unclassified 3427
182 Ga0501079_0030150 3300049741 Bacteria 4168
183 Ga0501079_0172371 3300049741 Bacteria 1687
184 Ga0501079_0265078 3300049741 Bacteria 1343
185 Ga0501045_0021998 3300049824 Bacteria 4562
186 nmdc:mga0k408_20269_c1 3300050493 Bacteria 3723
187 nmdc:mga05p37_287160_c1 3300050507 Bacteria 1959
188 nmdc:mga05p37_349578_c1 3300050507 Bacteria 1741
189 nmdc:mga05p37_616_c1 3300050507 Bacteria 39333
190 nmdc:mga05p37_6248_c1 3300050507 Bacteria 14026
191 nmdc:mga09592_55185_c1 3300050508 Bacteria 3357
192 nmdc:mga09592_60577_c1 3300050508 Bacteria 3200
193 nmdc:mga09592_67874_c1 3300050508 Bacteria 2542
194 nmdc:mga0qj67_19366_c1 3300050509 Bacteria 5199
195 nmdc:mga06r32_18982_c1 3300050510 Bacteria 6304
196 nmdc:mga06r32_78200_c1 3300050510 Bacteria 3215
197 nmdc:mga08y16_191846_c1 3300050511 Bacteria 2119
198 nmdc:mga08y16_2932_c1 3300050511 Bacteria 17564
199 nmdc:mga08y16_414513_c1 3300050511 Unclassified 1377
200 nmdc:mga0rr50_13939_c1 3300050513 Bacteria 5252
201 Ga0590075_000063 3300059424 Bacteria 26664
202 Ga0590077_000489 3300059426 Bacteria 11105
203 Ga0501082_0020896 3300060353 Bacteria 5647
204 Ga0501082_0282753 3300060353 Unclassified 1444
205 Ga0530510_0006238 3300061734 Bacteria 8291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100032900 Ga0307409_1000329002 330
2 3300005617 Ga0068859_100275141 Ga0068859_1002751413 342
3 3300006931 Ga0097620_100275144 Ga0097620_1002751441 342
4 3300050511 nmdc:mga08y16_414513_c1 nmdc:mga08y16_414513_c1_300_1361 344
5 3300005337 Ga0070682_100099151 Ga0070682_1000991512 350
6 3300005339 Ga0070660_100164354 Ga0070660_1001643542 350
7 3300005366 Ga0070659_100235618 Ga0070659_1002356182 350
8 3300025932 Ga0207690_10149911 Ga0207690_101499112 350
9 3300046475 Ga0495639_0141663 Ga0495639_0141663_12_1109 353
10 3300049572 Ga0501036_0077676 Ga0501036_0077676_1251_2432 355
11 3300049578 Ga0501042_0107165 Ga0501042_0107165_761_1942 355
12 3300049582 Ga0501048_0081216 Ga0501048_0081216_1028_2209 355
13 3300049588 Ga0501072_0022715 Ga0501072_0022715_3634_4815 355
14 3300049591 Ga0501075_0021818 Ga0501075_0021818_1142_2323 355
15 3300049824 Ga0501045_0021998 Ga0501045_0021998_3165_4346 355
16 3300060353 Ga0501082_0020896 Ga0501082_0020896_3202_4383 355
17 3300061734 Ga0530510_0006238 Ga0530510_0006238_2492_3673 355
18 3300031995 Ga0307409_100172973 Ga0307409_1001729732 366
19 3300005337 Ga0070682_100000059 Ga0070682_10000005953 370
20 3300009176 Ga0105242_10210987 Ga0105242_102109872 374
21 3300042125 Ga0450923_000752 Ga0450923_000752_16_1239 374
22 3300050507 nmdc:mga05p37_287160_c1 nmdc:mga05p37_287160_c1_411_1583 374
23 3300005456 Ga0070678_100195270 Ga0070678_1001952701 376
24 3300026088 Ga0207641_10293351 Ga0207641_102933511 376
25 3300049568 Ga0501031_0149679 Ga0501031_0149679_259_1476 376
26 3300049578 Ga0501042_0040442 Ga0501042_0040442_77_1294 376
27 3300049587 Ga0501071_0088562 Ga0501071_0088562_945_2162 376
28 3300049588 Ga0501072_0084078 Ga0501072_0084078_1228_2445 376
29 3300049592 Ga0501076_0232758 Ga0501076_0232758_47_1264 376
30 3300059424 Ga0590075_000063 Ga0590075_000063_20385_21683 377
31 3300059426 Ga0590077_000489 Ga0590077_000489_3245_4543 377
32 3300006846 Ga0075430_100026761 Ga0075430_1000267612 378
33 3300006880 Ga0075429_100034330 Ga0075429_1000343303 378
34 3300050508 nmdc:mga09592_60577_c1 nmdc:mga09592_60577_c1_1462_2682 378
35 3300005336 Ga0070680_100037178 Ga0070680_1000371783 379
36 3300005366 Ga0070659_100050353 Ga0070659_1000503532 379
37 3300005539 Ga0068853_100019200 Ga0068853_1000192001 379
38 3300005564 Ga0070664_100001444 Ga0070664_1000014446 379
39 3300014325 Ga0163163_10028745 Ga0163163_100287453 379
40 3300025912 Ga0207707_10007805 Ga0207707_100078056 379
41 3300025921 Ga0207652_10041245 Ga0207652_100412452 379
42 3300025932 Ga0207690_10087875 Ga0207690_100878751 379
43 3300025945 Ga0207679_10101892 Ga0207679_101018922 379
44 3300026116 Ga0207674_10000332 Ga0207674_1000033224 379
45 3300014326 Ga0157380_10098118 Ga0157380_100981182 381
46 3300005471 Ga0070698_100202725 Ga0070698_1002027251 382
47 3300049741 Ga0501079_0265078 Ga0501079_0265078_15_1250 382
48 3300050508 nmdc:mga09592_67874_c1 nmdc:mga09592_67874_c1_52_1287 382
49 3300005353 Ga0070669_100169504 Ga0070669_1001695042 383
50 3300009553 Ga0105249_10000201 Ga0105249_1000020118 383
51 3300013306 Ga0163162_10000128 Ga0163162_1000012818 383
52 3300025961 Ga0207712_10000330 Ga0207712_1000033026 383
53 3300025972 Ga0207668_10007655 Ga0207668_100076553 383
54 3300042461 Ga0439460_0017178 Ga0439460_0017178_291_1523 383
55 3300009177 Ga0105248_10044180 Ga0105248_100441803 385
56 3300013306 Ga0163162_10038124 Ga0163162_100381243 385
57 3300006846 Ga0075430_100231833 Ga0075430_1002318331 386
58 3300042435 Ga0439434_0033752 Ga0439434_0033752_139_1383 386
59 3300049588 Ga0501072_0099126 Ga0501072_0099126_44_1288 386
60 3300049592 Ga0501076_0018771 Ga0501076_0018771_1562_2806 386
61 3300049741 Ga0501079_0172371 Ga0501079_0172371_163_1407 386
62 3300005719 Ga0068861_100033870 Ga0068861_1000338702 387
63 3300009147 Ga0114129_10066973 Ga0114129_100669734 387
64 3300026118 Ga0207675_100090975 Ga0207675_1000909753 387
65 3300045051 Ga0451576_0017912 Ga0451576_0017912_54_1265 387
66 3300050507 nmdc:mga05p37_349578_c1 nmdc:mga05p37_349578_c1_111_1415 387
67 3300005719 Ga0068861_100088050 Ga0068861_1000880502 388
68 3300005841 Ga0068863_100143068 Ga0068863_1001430682 388
69 3300014969 Ga0157376_10104476 Ga0157376_101044762 388
70 3300026088 Ga0207641_10074237 Ga0207641_100742372 388
71 3300026118 Ga0207675_100236116 Ga0207675_1002361162 388
72 3300026121 Ga0207683_10219416 Ga0207683_102194162 388
73 3300047319 Ga0495674_0121850 Ga0495674_0121850_494_1708 388
74 3300050507 nmdc:mga05p37_6248_c1 nmdc:mga05p37_6248_c1_10707_11933 390
75 3300006871 Ga0075434_100055077 Ga0075434_1000550772 391
76 3300006881 Ga0068865_100123837 Ga0068865_1001238372 391
77 3300007076 Ga0075435_100017366 Ga0075435_1000173663 391
78 3300007076 Ga0075435_100327552 Ga0075435_1003275521 391
79 3300009094 Ga0111539_10004336 Ga0111539_100043366 391
80 3300035725 Ga0373947_0022134 Ga0373947_0022134_1841_3064 391
81 3300050513 nmdc:mga0rr50_13939_c1 nmdc:mga0rr50_13939_c1_2449_3684 391
82 3300005549 Ga0070704_100158658 Ga0070704_1001586581 392
83 3300006178 Ga0075367_10041384 Ga0075367_100413842 393
84 3300006844 Ga0075428_100014114 Ga0075428_1000141144 393
85 3300006846 Ga0075430_100093533 Ga0075430_1000935331 393
86 3300006847 Ga0075431_100079942 Ga0075431_1000799422 393
87 3300006847 Ga0075431_100165047 Ga0075431_1001650471 393
88 3300006880 Ga0075429_100041993 Ga0075429_1000419932 393
89 3300009147 Ga0114129_10024308 Ga0114129_100243083 393
90 3300049568 Ga0501031_0123826 Ga0501031_0123826_229_1467 393
91 3300049572 Ga0501036_0054392 Ga0501036_0054392_736_1974 393
92 3300050493 nmdc:mga0k408_20269_c1 nmdc:mga0k408_20269_c1_1663_2904 393
93 3300050507 nmdc:mga05p37_616_c1 nmdc:mga05p37_616_c1_28565_29803 393
94 3300050508 nmdc:mga09592_55185_c1 nmdc:mga09592_55185_c1_1594_2832 393
95 3300050509 nmdc:mga0qj67_19366_c1 nmdc:mga0qj67_19366_c1_172_1410 393
96 3300050510 nmdc:mga06r32_78200_c1 nmdc:mga06r32_78200_c1_819_2063 393
97 3300005295 Ga0065707_10086558 Ga0065707_100865583 394
98 3300005330 Ga0070690_100007604 Ga0070690_1000076041 394
99 3300005336 Ga0070680_100004103 Ga0070680_1000041037 394
100 3300005338 Ga0068868_100278632 Ga0068868_1002786321 394
101 3300005343 Ga0070687_100003799 Ga0070687_1000037991 394
102 3300005345 Ga0070692_10005924 Ga0070692_100059244 394
103 3300005353 Ga0070669_100008642 Ga0070669_1000086424 394
104 3300005364 Ga0070673_100004575 Ga0070673_1000045752 394
105 3300005441 Ga0070700_100007106 Ga0070700_1000071064 394
106 3300005444 Ga0070694_100069048 Ga0070694_1000690481 394
107 3300005457 Ga0070662_100226991 Ga0070662_1002269911 394
108 3300005458 Ga0070681_10000254 Ga0070681_1000025439 394
109 3300005458 Ga0070681_10010312 Ga0070681_100103123 394
110 3300005459 Ga0068867_100071488 Ga0068867_1000714882 394
111 3300005530 Ga0070679_100000029 Ga0070679_1000000293 394
112 3300005544 Ga0070686_100008042 Ga0070686_1000080423 394
113 3300005549 Ga0070704_100094066 Ga0070704_1000940662 394
114 3300005578 Ga0068854_100076502 Ga0068854_1000765022 394
115 3300005614 Ga0068856_100067135 Ga0068856_1000671351 394
116 3300005719 Ga0068861_100018429 Ga0068861_1000184294 394
117 3300005844 Ga0068862_100014136 Ga0068862_1000141363 394
118 3300005985 Ga0081539_10046889 Ga0081539_100468891 394
119 3300006871 Ga0075434_100134326 Ga0075434_1001343263 394
120 3300007076 Ga0075435_100036832 Ga0075435_1000368322 394
121 3300009094 Ga0111539_10166251 Ga0111539_101662513 394
122 3300009176 Ga0105242_10046911 Ga0105242_100469113 394
123 3300013297 Ga0157378_10014809 Ga0157378_100148093 394
124 3300013308 Ga0157375_10040407 Ga0157375_100404074 394
125 3300014326 Ga0157380_10005208 Ga0157380_100052084 394
126 3300025912 Ga0207707_10000060 Ga0207707_1000006096 394
127 3300025917 Ga0207660_10013327 Ga0207660_100133272 394
128 3300025921 Ga0207652_10000073 Ga0207652_1000007397 394
129 3300025923 Ga0207681_10014725 Ga0207681_100147253 394
130 3300026075 Ga0207708_10001112 Ga0207708_100011125 394
131 3300026089 Ga0207648_10143198 Ga0207648_101431981 394
132 3300026118 Ga0207675_100004930 Ga0207675_1000049308 394
133 3300028380 Ga0268265_10033817 Ga0268265_100338173 394
134 3300048905 Ga0496102_0058290 Ga0496102_0058290_2194_3417 394
135 3300049586 Ga0501070_0091684 Ga0501070_0091684_142_1398 394
136 3300049593 Ga0501077_0030566 Ga0501077_0030566_612_1868 394
137 3300049741 Ga0501079_0030150 Ga0501079_0030150_2387_3643 394
138 3300060353 Ga0501082_0282753 Ga0501082_0282753_176_1432 394
139 3300005334 Ga0068869_100140241 Ga0068869_1001402412 395
140 3300005549 Ga0070704_100009403 Ga0070704_1000094033 395
141 3300005842 Ga0068858_100083198 Ga0068858_1000831982 395
142 3300005842 Ga0068858_100122270 Ga0068858_1001222702 395
143 3300014326 Ga0157380_10000470 Ga0157380_1000047018 395
144 3300025904 Ga0207647_10130351 Ga0207647_101303511 395
145 3300025922 Ga0207646_10009236 Ga0207646_100092363 395
146 3300025942 Ga0207689_10028138 Ga0207689_100281382 395
147 3300026035 Ga0207703_10115469 Ga0207703_101154693 395
148 3300048915 Ga0496112_0081618 Ga0496112_0081618_1765_2991 395
149 3300005444 Ga0070694_100032727 Ga0070694_1000327272 396
150 3300005445 Ga0070708_100319448 Ga0070708_1003194481 396
151 3300005471 Ga0070698_100004385 Ga0070698_1000043858 396
152 3300005471 Ga0070698_100018133 Ga0070698_1000181334 396
153 3300005536 Ga0070697_100000018 Ga0070697_1000000188 396
154 3300005544 Ga0070686_100005534 Ga0070686_1000055344 396
155 3300005546 Ga0070696_100120916 Ga0070696_1001209161 396
156 3300005549 Ga0070704_100141486 Ga0070704_1001414862 396
157 3300009147 Ga0114129_10002249 Ga0114129_1000224916 396
158 3300025942 Ga0207689_10023652 Ga0207689_100236522 396
159 3300031548 Ga0307408_100098816 Ga0307408_1000988162 396
160 3300005290 Ga0065712_10069287 Ga0065712_100692874 397
161 3300005295 Ga0065707_10180254 Ga0065707_101802541 397
162 3300005330 Ga0070690_100040517 Ga0070690_1000405172 397
163 3300005338 Ga0068868_100110289 Ga0068868_1001102892 397
164 3300005340 Ga0070689_100183344 Ga0070689_1001833441 397
165 3300005353 Ga0070669_100052872 Ga0070669_1000528722 397
166 3300005355 Ga0070671_100175237 Ga0070671_1001752371 397
167 3300005356 Ga0070674_100072966 Ga0070674_1000729661 397
168 3300005441 Ga0070700_100089581 Ga0070700_1000895812 397
169 3300005466 Ga0070685_10026619 Ga0070685_100266193 397
170 3300005471 Ga0070698_100008280 Ga0070698_1000082803 397
171 3300005543 Ga0070672_100270581 Ga0070672_1002705811 397
172 3300005544 Ga0070686_100040045 Ga0070686_1000400451 397
173 3300005617 Ga0068859_100035967 Ga0068859_1000359673 397
174 3300005618 Ga0068864_100047696 Ga0068864_1000476962 397
175 3300005718 Ga0068866_10009045 Ga0068866_100090451 397
176 3300005842 Ga0068858_100112626 Ga0068858_1001126261 397
177 3300006237 Ga0097621_100002263 Ga0097621_1000022633 397
178 3300006844 Ga0075428_100006533 Ga0075428_1000065339 397
179 3300006844 Ga0075428_100098029 Ga0075428_1000980291 397
180 3300006847 Ga0075431_100020142 Ga0075431_1000201423 397
181 3300006880 Ga0075429_100291405 Ga0075429_1002914051 397
182 3300006931 Ga0097620_100035968 Ga0097620_1000359683 397
183 3300009094 Ga0111539_10008876 Ga0111539_100088766 397
184 3300009094 Ga0111539_10026016 Ga0111539_100260163 397
185 3300009094 Ga0111539_10106487 Ga0111539_101064872 397
186 3300009098 Ga0105245_10257285 Ga0105245_102572851 397
187 3300009174 Ga0105241_10013504 Ga0105241_100135043 397
188 3300009176 Ga0105242_10019976 Ga0105242_100199764 397
189 3300014325 Ga0163163_10160299 Ga0163163_101602992 397
190 3300014326 Ga0157380_10300625 Ga0157380_103006251 397
191 3300014745 Ga0157377_10062596 Ga0157377_100625962 397
192 3300017792 Ga0163161_10016306 Ga0163161_100163061 397
193 3300025923 Ga0207681_10013358 Ga0207681_100133581 397
194 3300025923 Ga0207681_10110978 Ga0207681_101109781 397
195 3300025931 Ga0207644_10002223 Ga0207644_100022236 397
196 3300025940 Ga0207691_10002560 Ga0207691_1000256010 397
197 3300025942 Ga0207689_10029494 Ga0207689_100294944 397
198 3300026075 Ga0207708_10094807 Ga0207708_100948072 397
199 3300026095 Ga0207676_10223498 Ga0207676_102234982 397
200 3300026118 Ga0207675_100002007 Ga0207675_10000200713 397
201 3300026121 Ga0207683_10266800 Ga0207683_102668002 397
202 3300027907 Ga0207428_10014381 Ga0207428_100143815 397
203 3300050510 nmdc:mga06r32_18982_c1 nmdc:mga06r32_18982_c1_3202_4455 397
204 3300050511 nmdc:mga08y16_191846_c1 nmdc:mga08y16_191846_c1_832_2085 397
205 3300050511 nmdc:mga08y16_2932_c1 nmdc:mga08y16_2932_c1_5351_6604 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

115

162

0.91

PF13570

PQQ_3

PQQ-like domain

388

423

0.87

PF13360

PQQ_2

PQQ-like domain

103

349

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8438 109 193
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8335 109 193
4pk1-assembly1.cif.gz_A structure of bamb fused to a bama potra domain fragment 0.7916 40 391
7tsz-assembly1.cif.gz_B bamabcde bound to substrate espp class 1 0.7835 41 391
2yms-assembly1.cif.gz_D structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7808 58 140
ID Description Score Start End Superfamily
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8438 109 193 2.40.10.480
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8335 109 193 2.40.10.480
af_Q4CX86_201_337_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8175 291 393 2.130.10.10
af_Q0ISH6_1_91_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8134 248 282 3.30.420.10
af_Q4CY91_191_384_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.804 287 396 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A7W1BXR5-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9849 229 397
AF-A0A7W1SGM5-F1-model_v4 PQQ-like beta-propeller repeat protein 0.9819 74 397
AF-A0A2V8DDW4-F1-model_v4 Polyvinylalcohol dehydrogenase 0.9765 119 397
AF-A0A3N5EI98-F1-model_v4 Polyvinylalcohol dehydrogenase 0.975 99 397
AF-A0A2V8B853-F1-model_v4 Polyvinylalcohol dehydrogenase 0.9739 210 397

Feature Viewer

pLDDT pTM Quality
84.74 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map