F313773

General Info

Members Datasets Scaffolds Average Seq Length
205 137 410 354

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10004234|Ga0105247_100042347
Length 394
Sequence LAPPLPPLRLLVVDDSAFNRRNIADLFAGNPDVEVVGKAADGEEALRLATVLKPDVITLDLEMPRMDGFTFLRILMSKQPTPVIVVSSYSQKENVFKALELGALDFVTKPDRQSEMTTSLNREAVPPSGSRGPSSAPPYSTSHAPERLASSDLREQIVSKVLLVRSLRPTAMVQPAVRRNMSVSGAFTVDGRPLLEGAPQPAVPPPPKHVIAIGSSTGGPSALLEIFGKIPATSTSGIVVAQHMPDKFTRTFAERLDRRGPVRCSEAQEGDRIGALTGFVCPGRQCMEVFARDGELRIKVVPANSGDRYVPSADRLLKSVAASAGARSVGVILTGMGDDGVEGARAIREAGGTVLAEAQETAVVFGMPGAAVRAGVVTKVLPLPAIAEYLAQLV

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
89 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0.49
Rhizosphere 88.78
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10004234 3300009101 Bacteria 9199
2 rootH2_10013321 3300003320 Bacteria 15294
3 rootH2_10029566 3300003320 Bacteria 8000
4 rootH1_10088991 3300003323 Bacteria 1528
5 rootH1_10120208 3300003323 Bacteria 4672
6 Ga0070683_100027637 3300005329 Bacteria 5119
7 Ga0070682_100001152 3300005337 Bacteria 15094
8 Ga0070682_100014410 3300005337 Bacteria 4567
9 Ga0070682_100190767 3300005337 Bacteria 1439
10 Ga0068868_100083310 3300005338 Bacteria 2567
11 Ga0070701_10013836 3300005438 Bacteria 3682
12 Ga0070700_100198791 3300005441 Bacteria 1407
13 Ga0070663_100045475 3300005455 Bacteria 3102
14 Ga0070678_100069951 3300005456 Bacteria 2622
15 Ga0070685_10094824 3300005466 Bacteria 1813
16 Ga0070707_100043488 3300005468 Bacteria 4299
17 Ga0070707_100271093 3300005468 Bacteria 1650
18 Ga0070679_100009700 3300005530 Bacteria 9107
19 Ga0070672_100000884 3300005543 Bacteria 17980
20 Ga0068855_100003589 3300005563 Bacteria 18952
21 Ga0068855_100015393 3300005563 Bacteria 9208
22 Ga0068856_100008680 3300005614 Bacteria 9887
23 Ga0070702_100114024 3300005615 Bacteria 1681
24 Ga0068859_100026258 3300005617 Bacteria 5840
25 Ga0068861_100114531 3300005719 Bacteria 2165
26 Ga0068861_100143120 3300005719 Bacteria 1954
27 Ga0068863_100238551 3300005841 Bacteria 1755
28 Ga0068860_100176920 3300005843 Bacteria 2062
29 Ga0070716_100103069 3300006173 Bacteria 1754
30 Ga0075366_10032539 3300006195 Bacteria 3069
31 Ga0068871_100056171 3300006358 Bacteria 3199
32 Ga0068871_100130055 3300006358 Bacteria 2134
33 Ga0068871_100380399 3300006358 Bacteria 1254
34 Ga0075428_100069603 3300006844 Bacteria 3847
35 Ga0075428_100179372 3300006844 Bacteria 2293
36 Ga0075436_100201885 3300006914 Bacteria 1408
37 Ga0097620_100026258 3300006931 Bacteria 5840
38 Ga0075435_100016250 3300007076 Bacteria 5611
39 Ga0111539_10011564 3300009094 Bacteria 11079
40 Ga0111539_10055761 3300009094 Bacteria 4698
41 Ga0105245_10105294 3300009098 Bacteria 2616
42 Ga0105243_10055835 3300009148 Bacteria 3138
43 Ga0163163_10060828 3300014325 Bacteria 3741
44 Ga0157377_10000260 3300014745 Bacteria 25939
45 Ga0157376_10076040 3300014969 Bacteria 2868
46 Ga0207710_10002837 3300025900 Bacteria 7897
47 Ga0207688_10094228 3300025901 Bacteria 1722
48 Ga0207652_10013775 3300025921 Bacteria 6539
49 Ga0207646_10033175 3300025922 Bacteria 4672
50 Ga0207687_10004166 3300025927 Bacteria 9684
51 Ga0207691_10002495 3300025940 Bacteria 17995
52 Ga0207661_10047105 3300025944 Bacteria 3421
53 Ga0207667_10003726 3300025949 Bacteria 18796
54 Ga0207667_10032555 3300025949 Bacteria 5616
55 Ga0207677_10003750 3300026023 Bacteria 8064
56 Ga0207677_10081901 3300026023 Bacteria 2318
57 Ga0207678_10058163 3300026067 Bacteria 3327
58 Ga0207702_10041857 3300026078 Bacteria 3841
59 Ga0207675_100003307 3300026118 Bacteria 15773
60 Ga0207675_100135620 3300026118 Bacteria 2335
61 Ga0207683_10078181 3300026121 Bacteria 2932
62 Ga0268266_10455234 3300028379 Bacteria 1217
63 Ga0265337_1002707 3300028556 Bacteria 7954
64 Ga0265319_1000141 3300028563 Bacteria 54186
65 Ga0265334_10040936 3300028573 Bacteria 1812
66 Ga0265318_10000292 3300028577 Bacteria 40936
67 Ga0265318_10000419 3300028577 Bacteria 32675
68 Ga0265318_10006086 3300028577 Bacteria 5592
69 Ga0265338_10066164 3300028800 Bacteria 3130
70 Ga0265338_10067360 3300028800 Bacteria 3093
71 Ga0265330_10004392 3300031235 Bacteria 7162
72 Ga0265332_10002605 3300031238 Bacteria 9122
73 Ga0265328_10023082 3300031239 Bacteria 2361
74 Ga0265320_10000263 3300031240 Bacteria 43371
75 Ga0265320_10022376 3300031240 Bacteria 3382
76 Ga0265325_10000518 3300031241 Bacteria 27904
77 Ga0265329_10001401 3300031242 Bacteria 11691
78 Ga0265340_10000887 3300031247 Bacteria 16943
79 Ga0265340_10004660 3300031247 Bacteria 7630
80 Ga0265340_10005601 3300031247 Bacteria 6960
81 Ga0265339_10003143 3300031249 Bacteria 11631
82 Ga0265339_10003393 3300031249 Bacteria 11147
83 Ga0265331_10004922 3300031250 Bacteria 8213
84 Ga0265316_10000599 3300031344 Bacteria 40220
85 Ga0265316_10003326 3300031344 Bacteria 16291
86 Ga0265316_10010415 3300031344 Bacteria 8473
87 Ga0265316_10234539 3300031344 Bacteria 1350
88 Ga0307509_10077947 3300031507 Bacteria 3436
89 Ga0307408_100023498 3300031548 Bacteria 4200
90 Ga0265313_10000059 3300031595 Bacteria 107320
91 Ga0265313_10001260 3300031595 Bacteria 24085
92 Ga0307508_10009207 3300031616 Bacteria 9095
93 Ga0307508_10021326 3300031616 Bacteria 5890
94 Ga0307514_10178701 3300031649 Bacteria 1372
95 Ga0265314_10000001 3300031711 Bacteria 3792860
96 Ga0265314_10006417 3300031711 Bacteria 10419
97 Ga0265314_10042717 3300031711 Bacteria 3230
98 Ga0265342_10000353 3300031712 Bacteria 51383
99 Ga0265342_10028262 3300031712 Bacteria 3497
100 Ga0316578_10007543 3300031728 Bacteria 5464
101 Ga0307516_10008249 3300031730 Bacteria 11824
102 Ga0307405_10033802 3300031731 Bacteria 3037
103 Ga0307410_10016951 3300031852 Bacteria 4359
104 Ga0307406_10018294 3300031901 Bacteria 4091
105 Ga0307412_10057097 3300031911 Bacteria 2604
106 Ga0307412_10063987 3300031911 Bacteria 2484
107 Ga0307409_100009620 3300031995 Bacteria 5953
108 Ga0307416_100161984 3300032002 Bacteria 2069
109 Ga0307411_10020720 3300032005 Bacteria 3832
110 Ga0307415_100247569 3300032126 Bacteria 1446
111 Ga0307507_10043982 3300033179 Bacteria 4423
112 Ga0373926_0000614 3300035083 Bacteria 9676
113 Ga0373955_0090819 3300035172 Bacteria 1740
114 Ga0373935_0008408 3300035692 Bacteria 6177
115 Ga0373935_0103067 3300035692 Bacteria 1884
116 Ga0373935_0278535 3300035692 Bacteria 1177
117 Ga0373937_0016812 3300036401 Bacteria 6503
118 Ga0373937_0161919 3300036401 Bacteria 2098
119 Ga0373937_0386699 3300036401 Bacteria 1327
120 Ga0373937_0473831 3300036401 Bacteria 1189
121 Ga0316582_0105918 3300036647 Bacteria 1867
122 Ga0316584_0052609 3300036712 Bacteria 3046
123 Ga0400490_08047 3300038726 Bacteria 39254
124 Ga0400491_10430 3300038727 Bacteria 2574
125 Ga0400483_243657 3300039062 Bacteria 1763
126 Ga0400489_10152 3300039093 Bacteria 3987
127 Ga0451849_1147875 3300041505 Bacteria 4065
128 Ga0451853_1341753 3300041512 Bacteria 5277
129 Ga0439445_0025479 3300042004 Bacteria 1509
130 Ga0451577_0000029 3300042876 Bacteria 395301
131 Ga0451577_0009113 3300042876 Bacteria 9577
132 Ga0451577_0025969 3300042876 Bacteria 5308
133 Ga0451577_0032840 3300042876 Bacteria 4678
134 Ga0451577_0039478 3300042876 Bacteria 4242
135 Ga0451577_0054194 3300042876 Bacteria 3580
136 Ga0451577_0124040 3300042876 Bacteria 2314
137 Ga0451577_0154948 3300042876 Bacteria 2062
138 Ga0453683_0000253 3300044673 Bacteria 70186
139 Ga0453683_0000438 3300044673 Bacteria 47738
140 Ga0453683_0001592 3300044673 Bacteria 19183
141 Ga0453683_0007661 3300044673 Bacteria 7312
142 Ga0453683_0009085 3300044673 Bacteria 6639
143 Ga0453683_0016235 3300044673 Bacteria 4809
144 Ga0453683_0082693 3300044673 Bacteria 2012
145 Ga0453683_0114344 3300044673 Bacteria 1698
146 Ga0466965_0173169 3300044683 Bacteria 1136
147 Ga0466963_0132892 3300044694 Bacteria 1720
148 Ga0453684_0000088 3300044712 Bacteria 395200
149 Ga0453684_0005913 3300044712 Bacteria 23725
150 Ga0453684_0011238 3300044712 Bacteria 15070
151 Ga0453684_0016897 3300044712 Bacteria 11355
152 Ga0453684_0069018 3300044712 Bacteria 4485
153 Ga0453684_0087497 3300044712 Bacteria 3861
154 Ga0453684_0115901 3300044712 Bacteria 3246
155 Ga0453684_0124148 3300044712 Bacteria 3110
156 Ga0453684_0354598 3300044712 Unclassified 1653
157 Ga0453684_0397139 3300044712 Bacteria 1545
158 Ga0466957_0065834 3300044842 Bacteria 2233
159 Ga0451576_0008311 3300045051 Bacteria 12202
160 Ga0451576_0082355 3300045051 Bacteria 3347
161 Ga0451576_0137366 3300045051 Bacteria 2549
162 Ga0451576_0170121 3300045051 Bacteria 2274
163 Ga0451576_0525537 3300045051 Bacteria 1243
164 Ga0466967_0401524 3300045976 Bacteria 1334
165 Ga0495651_0000126 3300046462 Bacteria 56547
166 Ga0495651_0009981 3300046462 Bacteria 7300
167 Ga0495580_0045935 3300046472 Bacteria 3101
168 Ga0495652_0010366 3300046529 Bacteria 8445
169 Ga0495665_0006793 3300046531 Bacteria 6172
170 Ga0495586_0000405 3300046535 Bacteria 26188
171 Ga0495586_0029762 3300046535 Bacteria 2924
172 Ga0495645_0032793 3300046543 Bacteria 3789
173 Ga0495667_0002288 3300046559 Bacteria 12842
174 Ga0495623_0003934 3300046679 Bacteria 9790
175 Ga0495646_0000785 3300046680 Bacteria 17756
176 Ga0495624_0030993 3300046690 Bacteria 3480
177 Ga0495581_0146420 3300047315 Bacteria 1379
178 Ga0495680_0000253 3300047322 Bacteria 59346
179 Ga0495680_0057891 3300047322 Bacteria 2996
180 Ga0495675_0005957 3300047444 Bacteria 7451
181 Ga0495675_0021211 3300047444 Unclassified 4136
182 Ga0495684_0004995 3300047471 Bacteria 10352
183 Ga0495593_0003134 3300047673 Bacteria 9937
184 Ga0495614_0014875 3300048089 Bacteria 3400
185 Ga0496114_0135670 3300048917 Bacteria 2128
186 Ga0501034_0029583 3300049571 Bacteria 5570
187 Ga0501047_0037967 3300049581 Bacteria 4659
188 Ga0501067_0180846 3300049583 Bacteria 1174
189 Ga0501072_0253639 3300049588 Bacteria 1401
190 Ga0501073_0325852 3300049589 Bacteria 1060
191 Ga0501077_0013729 3300049593 Bacteria 5078
192 Ga0501083_0052240 3300049744 Bacteria 2746
193 nmdc:mga0k408_40763_c1 3300050493 Bacteria 2673
194 nmdc:mga0k408_61414_c1 3300050493 Bacteria 2184
195 nmdc:mga09592_345944_c1 3300050508 Bacteria 1287
196 nmdc:mga08y16_17725_c1 3300050511 Bacteria 7499
197 nmdc:mga08y16_25004_c1 3300050511 Bacteria 6300
198 nmdc:mga0rr50_141680_c1 3300050513 Bacteria 1935
199 nmdc:mga08x19_179074_c1 3300050514 Bacteria 1446
200 Ga0495612_0001153 3300053078 Bacteria 10841
201 Ga0495619_0117034 3300053085 Bacteria 1825
202 Ga0500555_002628 3300053103 Bacteria 5180
203 Ga0500588_0025944 3300053146 Unclassified 1634
204 Ga0501082_0428517 3300060353 Bacteria 1155
205 2854682844 2854681122 Bacteria 4548679
206 Ga0105247_10004234
207 rootH2_10013321
208 rootH2_10029566
209 rootH1_10088991
210 rootH1_10120208
211 Ga0070683_100027637
212 Ga0070682_100001152
213 Ga0070682_100014410
214 Ga0070682_100190767
215 Ga0068868_100083310
216 Ga0070701_10013836
217 Ga0070700_100198791
218 Ga0070663_100045475
219 Ga0070678_100069951
220 Ga0070685_10094824
221 Ga0070707_100043488
222 Ga0070707_100271093
223 Ga0070679_100009700
224 Ga0070672_100000884
225 Ga0068855_100003589
226 Ga0068855_100015393
227 Ga0068856_100008680
228 Ga0070702_100114024
229 Ga0068859_100026258
230 Ga0068861_100114531
231 Ga0068861_100143120
232 Ga0068863_100238551
233 Ga0068860_100176920
234 Ga0070716_100103069
235 Ga0075366_10032539
236 Ga0068871_100056171
237 Ga0068871_100130055
238 Ga0068871_100380399
239 Ga0075428_100069603
240 Ga0075428_100179372
241 Ga0075436_100201885
242 Ga0097620_100026258
243 Ga0075435_100016250
244 Ga0111539_10011564
245 Ga0111539_10055761
246 Ga0105245_10105294
247 Ga0105243_10055835
248 Ga0163163_10060828
249 Ga0157377_10000260
250 Ga0157376_10076040
251 Ga0207710_10002837
252 Ga0207688_10094228
253 Ga0207652_10013775
254 Ga0207646_10033175
255 Ga0207687_10004166
256 Ga0207691_10002495
257 Ga0207661_10047105
258 Ga0207667_10003726
259 Ga0207667_10032555
260 Ga0207677_10003750
261 Ga0207677_10081901
262 Ga0207678_10058163
263 Ga0207702_10041857
264 Ga0207675_100003307
265 Ga0207675_100135620
266 Ga0207683_10078181
267 Ga0268266_10455234
268 Ga0265337_1002707
269 Ga0265319_1000141
270 Ga0265334_10040936
271 Ga0265318_10000292
272 Ga0265318_10000419
273 Ga0265318_10006086
274 Ga0265338_10066164
275 Ga0265338_10067360
276 Ga0265330_10004392
277 Ga0265332_10002605
278 Ga0265328_10023082
279 Ga0265320_10000263
280 Ga0265320_10022376
281 Ga0265325_10000518
282 Ga0265329_10001401
283 Ga0265340_10000887
284 Ga0265340_10004660
285 Ga0265340_10005601
286 Ga0265339_10003143
287 Ga0265339_10003393
288 Ga0265331_10004922
289 Ga0265316_10000599
290 Ga0265316_10003326
291 Ga0265316_10010415
292 Ga0265316_10234539
293 Ga0307509_10077947
294 Ga0307408_100023498
295 Ga0265313_10000059
296 Ga0265313_10001260
297 Ga0307508_10009207
298 Ga0307508_10021326
299 Ga0307514_10178701
300 Ga0265314_10000001
301 Ga0265314_10006417
302 Ga0265314_10042717
303 Ga0265342_10000353
304 Ga0265342_10028262
305 Ga0316578_10007543
306 Ga0307516_10008249
307 Ga0307405_10033802
308 Ga0307410_10016951
309 Ga0307406_10018294
310 Ga0307412_10057097
311 Ga0307412_10063987
312 Ga0307409_100009620
313 Ga0307416_100161984
314 Ga0307411_10020720
315 Ga0307415_100247569
316 Ga0307507_10043982
317 Ga0373926_0000614
318 Ga0373955_0090819
319 Ga0373935_0008408
320 Ga0373935_0103067
321 Ga0373935_0278535
322 Ga0373937_0016812
323 Ga0373937_0161919
324 Ga0373937_0386699
325 Ga0373937_0473831
326 Ga0316582_0105918
327 Ga0316584_0052609
328 Ga0400490_08047
329 Ga0400491_10430
330 Ga0400483_243657
331 Ga0400489_10152
332 Ga0451849_1147875
333 Ga0451853_1341753
334 Ga0439445_0025479
335 Ga0451577_0000029
336 Ga0451577_0009113
337 Ga0451577_0025969
338 Ga0451577_0032840
339 Ga0451577_0039478
340 Ga0451577_0054194
341 Ga0451577_0124040
342 Ga0451577_0154948
343 Ga0453683_0000253
344 Ga0453683_0000438
345 Ga0453683_0001592
346 Ga0453683_0007661
347 Ga0453683_0009085
348 Ga0453683_0016235
349 Ga0453683_0082693
350 Ga0453683_0114344
351 Ga0466965_0173169
352 Ga0466963_0132892
353 Ga0453684_0000088
354 Ga0453684_0005913
355 Ga0453684_0011238
356 Ga0453684_0016897
357 Ga0453684_0069018
358 Ga0453684_0087497
359 Ga0453684_0115901
360 Ga0453684_0124148
361 Ga0453684_0354598
362 Ga0453684_0397139
363 Ga0466957_0065834
364 Ga0451576_0008311
365 Ga0451576_0082355
366 Ga0451576_0137366
367 Ga0451576_0170121
368 Ga0451576_0525537
369 Ga0466967_0401524
370 Ga0495651_0000126
371 Ga0495651_0009981
372 Ga0495580_0045935
373 Ga0495652_0010366
374 Ga0495665_0006793
375 Ga0495586_0000405
376 Ga0495586_0029762
377 Ga0495645_0032793
378 Ga0495667_0002288
379 Ga0495623_0003934
380 Ga0495646_0000785
381 Ga0495624_0030993
382 Ga0495581_0146420
383 Ga0495680_0000253
384 Ga0495680_0057891
385 Ga0495675_0005957
386 Ga0495675_0021211
387 Ga0495684_0004995
388 Ga0495593_0003134
389 Ga0495614_0014875
390 Ga0496114_0135670
391 Ga0501034_0029583
392 Ga0501047_0037967
393 Ga0501067_0180846
394 Ga0501072_0253639
395 Ga0501073_0325852
396 Ga0501077_0013729
397 Ga0501083_0052240
398 nmdc:mga0k408_40763_c1
399 nmdc:mga0k408_61414_c1
400 nmdc:mga09592_345944_c1
401 nmdc:mga08y16_17725_c1
402 nmdc:mga08y16_25004_c1
403 nmdc:mga0rr50_141680_c1
404 nmdc:mga08x19_179074_c1
405 Ga0495612_0001153
406 Ga0495619_0117034
407 Ga0500555_002628
408 Ga0500588_0025944
409 Ga0501082_0428517
410 2854682844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

10

121

0.96

PF01339

CheB_methylest

CheB methylesterase

211

390

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9633 169 353
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.952 163 351
3t8y-assembly1.cif.gz_A crystal structure of the response regulator domain of thermotoga maritima cheb 0.9382 8 133
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9337 169 353
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.9305 9 133
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9633 169 353 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9432 165 353 3.40.50.180
3t8yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9382 8 133 3.40.50.2300
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9337 169 353 3.40.50.180
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9325 10 88 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y6XAH8-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9839 270 353 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-F4A1W0-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9775 168 353 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A7Z9QTH3-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9649 167 353 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A1W9LM16-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.963 204 353 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A4Y1ZA51-F1-model_v4 DNA-binding response regulator, LuxR family 0.9627 10 82 GO:0000160
GO:0003677

Map