F313616

General Info

Members Datasets Scaffolds Average Seq Length
205 143 410 119

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_101490822|Ga0068864_1014908222
Length 123
Sequence MPQLTVDGVGTFETPAGKRLVNAMSDEAGIDQLHACGGNARCTTCRVQFVSGNPDKMTVAEKELLAVRGIDKQFPDVRLSCQIACDHDMTVKAISRLAGSGRVDAGKRPDDQIQPPPVWTTRS

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 1.95
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 19.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_101490822 3300005618 Unclassified 679
2 JGI24743J22301_10049440 3300001991 Unclassified 855
3 JGI24735J21928_10049479 3300002067 Bacteria 1215
4 Ga0065712_10088398 3300005290 Bacteria 2522
5 Ga0065712_10372634 3300005290 Unclassified 761
6 Ga0065715_10095179 3300005293 Bacteria 4144
7 Ga0070658_10035395 3300005327 Bacteria 4021
8 Ga0070683_100667864 3300005329 Bacteria 995
9 Ga0070670_100746268 3300005331 Bacteria 882
10 Ga0070670_100916246 3300005331 Bacteria 795
11 Ga0070670_102208000 3300005331 Bacteria 507
12 Ga0068869_100043297 3300005334 Bacteria 3232
13 Ga0068868_100132994 3300005338 Bacteria 2037
14 Ga0068868_101302883 3300005338 Bacteria 675
15 Ga0070691_10090238 3300005341 Bacteria 1510
16 Ga0070661_101591918 3300005344 Bacteria 552
17 Ga0070692_10041260 3300005345 Bacteria 2363
18 Ga0070675_100569978 3300005354 Bacteria 1025
19 Ga0070675_101596871 3300005354 Bacteria 602
20 Ga0070671_100066737 3300005355 Bacteria 2998
21 Ga0070671_100108104 3300005355 Bacteria 2336
22 Ga0070674_100030351 3300005356 Bacteria 3570
23 Ga0070674_100349270 3300005356 Bacteria 1194
24 Ga0070674_101504482 3300005356 Unclassified 605
25 Ga0070688_100866971 3300005365 Bacteria 710
26 Ga0070659_100124086 3300005366 Unclassified 2094
27 Ga0070667_100044198 3300005367 Bacteria 3740
28 Ga0070667_100361498 3300005367 Bacteria 1316
29 Ga0070667_100629663 3300005367 Bacteria 990
30 Ga0070694_100401728 3300005444 Bacteria 1073
31 Ga0070708_100662658 3300005445 Bacteria 983
32 Ga0070663_100418960 3300005455 Bacteria 1098
33 Ga0070681_10073835 3300005458 Bacteria 3372
34 Ga0068867_100210255 3300005459 Unclassified 1562
35 Ga0070685_10906868 3300005466 Unclassified 656
36 Ga0070699_100410606 3300005518 Bacteria 1225
37 Ga0070684_100119404 3300005535 Bacteria 2371
38 Ga0070672_100181282 3300005543 Bacteria 1755
39 Ga0070672_100271460 3300005543 Bacteria 1432
40 Ga0070695_100023314 3300005545 Bacteria 3801
41 Ga0070695_100554925 3300005545 Bacteria 896
42 Ga0070693_100603334 3300005547 Unclassified 793
43 Ga0070665_100239068 3300005548 Bacteria 1817
44 Ga0070704_100074782 3300005549 Bacteria 2472
45 Ga0070664_100466802 3300005564 Unclassified 1160
46 Ga0070664_101034871 3300005564 Bacteria 772
47 Ga0068854_101122766 3300005578 Unclassified 701
48 Ga0070702_100148836 3300005615 Bacteria 1500
49 Ga0070702_100442211 3300005615 Bacteria 941
50 Ga0068859_100064172 3300005617 Unclassified 3705
51 Ga0068864_100339435 3300005618 Bacteria 1415
52 Ga0068864_101563160 3300005618 Unclassified 663
53 Ga0068861_100117673 3300005719 Bacteria 2139
54 Ga0068861_100289515 3300005719 Bacteria 1414
55 Ga0068863_101058579 3300005841 Unclassified 815
56 Ga0068863_101433961 3300005841 Unclassified 698
57 Ga0068863_101885153 3300005841 Unclassified 608
58 Ga0068858_100022312 3300005842 Bacteria 5911
59 Ga0068858_100156087 3300005842 Unclassified 2147
60 Ga0068858_100493988 3300005842 Bacteria 1182
61 Ga0081539_10008659 3300005985 Bacteria 8766
62 Ga0075368_10118842 3300006042 Bacteria 1093
63 Ga0075364_10099623 3300006051 Bacteria 1934
64 Ga0075367_10016922 3300006178 Bacteria 3991
65 Ga0075366_10042607 3300006195 Bacteria 2687
66 Ga0097621_101349794 3300006237 Unclassified 674
67 Ga0075370_10081421 3300006353 Bacteria 1861
68 Ga0075428_100030088 3300006844 Bacteria 6006
69 Ga0075430_100007662 3300006846 Bacteria 9118
70 Ga0075430_100105638 3300006846 Unclassified 2350
71 Ga0075431_100008757 3300006847 Bacteria 10138
72 Ga0075431_100714199 3300006847 Bacteria 979
73 Ga0075431_101588284 3300006847 Bacteria 612
74 Ga0075433_10033940 3300006852 Bacteria 4378
75 Ga0075434_100244550 3300006871 Unclassified 1814
76 Ga0075429_100039157 3300006880 Bacteria 4126
77 Ga0097620_100064173 3300006931 Unclassified 3705
78 Ga0114129_10002928 3300009147 Bacteria 23878
79 Ga0114129_10019677 3300009147 Bacteria 9609
80 Ga0114129_10040298 3300009147 Bacteria 6584
81 Ga0105248_10693249 3300009177 Unclassified 1149
82 Ga0105246_10161894 3300011119 Bacteria 1705
83 Ga0157369_10405195 3300013105 Unclassified 1415
84 Ga0157374_11318484 3300013296 Unclassified 744
85 Ga0157378_10418272 3300013297 Bacteria 1324
86 Ga0163162_12268218 3300013306 Bacteria 623
87 Ga0157372_10847100 3300013307 Bacteria 1061
88 Ga0157372_11281487 3300013307 Bacteria 846
89 Ga0163163_10122392 3300014325 Bacteria 2636
90 Ga0163163_10129249 3300014325 Bacteria 2566
91 Ga0163163_10196468 3300014325 Bacteria 2065
92 Ga0157377_10648133 3300014745 Unclassified 760
93 Ga0157377_11138871 3300014745 Bacteria 600
94 Ga0157379_10007583 3300014968 Bacteria 9396
95 Ga0157379_10920755 3300014968 Unclassified 830
96 Ga0157376_10342683 3300014969 Bacteria 1428
97 Ga0157376_11551792 3300014969 Bacteria 696
98 Ga0207697_10001439 3300025315 Bacteria 13015
99 Ga0207688_10002027 3300025901 Bacteria 10871
100 Ga0207645_10309943 3300025907 Unclassified 1052
101 Ga0207705_10004390 3300025909 Bacteria 10654
102 Ga0207707_10087945 3300025912 Bacteria 2714
103 Ga0207660_10935134 3300025917 Bacteria 707
104 Ga0207660_11237139 3300025917 Unclassified 607
105 Ga0207649_11298394 3300025920 Bacteria 576
106 Ga0207650_10785741 3300025925 Bacteria 806
107 Ga0207659_10087674 3300025926 Bacteria 2317
108 Ga0207644_10077890 3300025931 Bacteria 2443
109 Ga0207644_10532307 3300025931 Bacteria 971
110 Ga0207709_10181729 3300025935 Bacteria 1486
111 Ga0207669_10629119 3300025937 Bacteria 875
112 Ga0207691_10139394 3300025940 Bacteria 2138
113 Ga0207691_10296268 3300025940 Unclassified 1390
114 Ga0207711_10625618 3300025941 Unclassified 1004
115 Ga0207689_10082988 3300025942 Bacteria 2635
116 Ga0207661_10438806 3300025944 Bacteria 1188
117 Ga0207661_10916672 3300025944 Bacteria 807
118 Ga0207679_10133508 3300025945 Bacteria 1995
119 Ga0207658_10179696 3300025986 Bacteria 1750
120 Ga0207658_10183920 3300025986 Bacteria 1732
121 Ga0207658_10528070 3300025986 Bacteria 1054
122 Ga0207677_10252185 3300026023 Bacteria 1434
123 Ga0207703_10152705 3300026035 Unclassified 2015
124 Ga0207703_10232331 3300026035 Bacteria 1654
125 Ga0207641_10550770 3300026088 Bacteria 1125
126 Ga0207641_10809998 3300026088 Bacteria 927
127 Ga0207648_10201897 3300026089 Unclassified 1763
128 Ga0207648_10721563 3300026089 Bacteria 925
129 Ga0207676_10230320 3300026095 Bacteria 1656
130 Ga0207676_10856625 3300026095 Unclassified 889
131 Ga0207675_100136028 3300026118 Bacteria 2332
132 Ga0207675_100255972 3300026118 Bacteria 1696
133 Ga0207683_11078952 3300026121 Unclassified 745
134 Ga0209813_10016608 3300027866 Bacteria 2011
135 Ga0209813_10326352 3300027866 Unclassified 602
136 Ga0268266_10099943 3300028379 Bacteria 2555
137 Ga0268266_10238358 3300028379 Bacteria 1678
138 Ga0268264_10235745 3300028381 Bacteria 1692
139 Ga0265325_10018743 3300031241 Bacteria 3837
140 Ga0307408_100096954 3300031548 Unclassified 2239
141 Ga0307408_102325599 3300031548 Unclassified 519
142 Ga0307407_10314483 3300031903 Bacteria 1097
143 Ga0307409_100005556 3300031995 Bacteria 7282
144 Ga0307416_101274644 3300032002 Bacteria 841
145 Ga0307411_11221175 3300032005 Bacteria 682
146 Ga0373953_0052455 3300035117 Bacteria 1651
147 Ga0373937_0142708 3300036401 Bacteria 2241
148 Ga0436364_1284771 3300037853 Bacteria 551
149 Ga0436363_0997851 3300039450 Bacteria 578
150 Ga0451791_1600159 3300041451 Unclassified 1185
151 Ga0451797_1189918 3300041453 Bacteria 732
152 Ga0451807_0115278 3300041486 Bacteria 1432
153 Ga0451853_1859521 3300041512 Bacteria 1368
154 Ga0439446_0039973 3300042156 Archaea 1379
155 Ga0439444_0130724 3300042437 Bacteria 593
156 Ga0453684_0065251 3300044712 Bacteria 4644
157 Ga0466967_0342577 3300045976 Bacteria 1446
158 Ga0496110_0225027 3300048913 Bacteria 1706
159 Ga0501034_0304311 3300049571 Bacteria 1530
160 Ga0501034_0566831 3300049571 Bacteria 1044
161 Ga0501036_0076470 3300049572 Bacteria 2832
162 Ga0501036_0279653 3300049572 Bacteria 1397
163 Ga0501038_0166615 3300049574 Bacteria 1787
164 Ga0501039_0320264 3300049575 Bacteria 1219
165 Ga0501041_0108182 3300049577 Bacteria 1724
166 Ga0501046_0296260 3300049580 Bacteria 1182
167 Ga0501047_0055452 3300049581 Bacteria 3833
168 Ga0501047_0351552 3300049581 Bacteria 1310
169 Ga0501048_0112954 3300049582 Bacteria 1919
170 Ga0501067_0065909 3300049583 Bacteria 2005
171 Ga0501071_0016908 3300049587 Bacteria 5020
172 Ga0501071_0112336 3300049587 Bacteria 2015
173 Ga0501072_0041099 3300049588 Bacteria 3631
174 Ga0501076_0154840 3300049592 Bacteria 1865
175 Ga0501076_1197583 3300049592 Bacteria 625
176 Ga0501077_0136307 3300049593 Bacteria 1557
177 Ga0501077_0151991 3300049593 Bacteria 1469
178 Ga0501079_0020956 3300049741 Bacteria 4996
179 Ga0501081_0265728 3300049743 Bacteria 1254
180 Ga0501272_065798 3300049769 Bacteria 524
181 Ga0501045_0005071 3300049824 Bacteria 9116
182 Ga0501045_0055281 3300049824 Bacteria 2903
183 nmdc:mga00v17_61978_c1 3300050491 Bacteria 2300
184 nmdc:mga00v17_94244_c1 3300050491 Bacteria 1884
185 nmdc:mga06z11_203566_c1 3300050494 Bacteria 1151
186 nmdc:mga06z11_451628_c1 3300050494 Bacteria 776
187 nmdc:mga04h51_139753_c1 3300050495 Bacteria 918
188 nmdc:mga07m45_36034_c2 3300050496 Bacteria 1351
189 nmdc:mga07m45_43586_c1 3300050496 Bacteria 2516
190 nmdc:mga05p37_2518_c1 3300050507 Bacteria 21290
191 nmdc:mga05p37_52467_c1 3300050507 Bacteria 5014
192 nmdc:mga09592_219106_c1 3300050508 Bacteria 1649
193 nmdc:mga09592_41922_c1 3300050508 Bacteria 3850
194 nmdc:mga0qj67_5556_c1 3300050509 Bacteria 9219
195 nmdc:mga06r32_1359362_c1 3300050510 Bacteria 653
196 nmdc:mga0a205_83874_c1 3300050515 Bacteria 3078
197 Ga0500641_0006164 3300053096 Bacteria 4251
198 Ga0501084_0021025 3300054114 Bacteria 5444
199 Ga0501084_0257407 3300054114 Unclassified 1473
200 Ga0501084_0476452 3300054114 Bacteria 1055
201 Ga0590075_060742 3300059424 Bacteria 974
202 Ga0501082_0013278 3300060353 Bacteria 7083
203 Ga0501082_1518107 3300060353 Unclassified 585
204 Ga0530510_0002025 3300061734 Bacteria 13919
205 Ga0530510_1459858 3300061734 Bacteria 525
206 Ga0068864_101490822
207 JGI24743J22301_10049440
208 JGI24735J21928_10049479
209 Ga0065712_10088398
210 Ga0065712_10372634
211 Ga0065715_10095179
212 Ga0070658_10035395
213 Ga0070683_100667864
214 Ga0070670_100746268
215 Ga0070670_100916246
216 Ga0070670_102208000
217 Ga0068869_100043297
218 Ga0068868_100132994
219 Ga0068868_101302883
220 Ga0070691_10090238
221 Ga0070661_101591918
222 Ga0070692_10041260
223 Ga0070675_100569978
224 Ga0070675_101596871
225 Ga0070671_100066737
226 Ga0070671_100108104
227 Ga0070674_100030351
228 Ga0070674_100349270
229 Ga0070674_101504482
230 Ga0070688_100866971
231 Ga0070659_100124086
232 Ga0070667_100044198
233 Ga0070667_100361498
234 Ga0070667_100629663
235 Ga0070694_100401728
236 Ga0070708_100662658
237 Ga0070663_100418960
238 Ga0070681_10073835
239 Ga0068867_100210255
240 Ga0070685_10906868
241 Ga0070699_100410606
242 Ga0070684_100119404
243 Ga0070672_100181282
244 Ga0070672_100271460
245 Ga0070695_100023314
246 Ga0070695_100554925
247 Ga0070693_100603334
248 Ga0070665_100239068
249 Ga0070704_100074782
250 Ga0070664_100466802
251 Ga0070664_101034871
252 Ga0068854_101122766
253 Ga0070702_100148836
254 Ga0070702_100442211
255 Ga0068859_100064172
256 Ga0068864_100339435
257 Ga0068864_101563160
258 Ga0068861_100117673
259 Ga0068861_100289515
260 Ga0068863_101058579
261 Ga0068863_101433961
262 Ga0068863_101885153
263 Ga0068858_100022312
264 Ga0068858_100156087
265 Ga0068858_100493988
266 Ga0081539_10008659
267 Ga0075368_10118842
268 Ga0075364_10099623
269 Ga0075367_10016922
270 Ga0075366_10042607
271 Ga0097621_101349794
272 Ga0075370_10081421
273 Ga0075428_100030088
274 Ga0075430_100007662
275 Ga0075430_100105638
276 Ga0075431_100008757
277 Ga0075431_100714199
278 Ga0075431_101588284
279 Ga0075433_10033940
280 Ga0075434_100244550
281 Ga0075429_100039157
282 Ga0097620_100064173
283 Ga0114129_10002928
284 Ga0114129_10019677
285 Ga0114129_10040298
286 Ga0105248_10693249
287 Ga0105246_10161894
288 Ga0157369_10405195
289 Ga0157374_11318484
290 Ga0157378_10418272
291 Ga0163162_12268218
292 Ga0157372_10847100
293 Ga0157372_11281487
294 Ga0163163_10122392
295 Ga0163163_10129249
296 Ga0163163_10196468
297 Ga0157377_10648133
298 Ga0157377_11138871
299 Ga0157379_10007583
300 Ga0157379_10920755
301 Ga0157376_10342683
302 Ga0157376_11551792
303 Ga0207697_10001439
304 Ga0207688_10002027
305 Ga0207645_10309943
306 Ga0207705_10004390
307 Ga0207707_10087945
308 Ga0207660_10935134
309 Ga0207660_11237139
310 Ga0207649_11298394
311 Ga0207650_10785741
312 Ga0207659_10087674
313 Ga0207644_10077890
314 Ga0207644_10532307
315 Ga0207709_10181729
316 Ga0207669_10629119
317 Ga0207691_10139394
318 Ga0207691_10296268
319 Ga0207711_10625618
320 Ga0207689_10082988
321 Ga0207661_10438806
322 Ga0207661_10916672
323 Ga0207679_10133508
324 Ga0207658_10179696
325 Ga0207658_10183920
326 Ga0207658_10528070
327 Ga0207677_10252185
328 Ga0207703_10152705
329 Ga0207703_10232331
330 Ga0207641_10550770
331 Ga0207641_10809998
332 Ga0207648_10201897
333 Ga0207648_10721563
334 Ga0207676_10230320
335 Ga0207676_10856625
336 Ga0207675_100136028
337 Ga0207675_100255972
338 Ga0207683_11078952
339 Ga0209813_10016608
340 Ga0209813_10326352
341 Ga0268266_10099943
342 Ga0268266_10238358
343 Ga0268264_10235745
344 Ga0265325_10018743
345 Ga0307408_100096954
346 Ga0307408_102325599
347 Ga0307407_10314483
348 Ga0307409_100005556
349 Ga0307416_101274644
350 Ga0307411_11221175
351 Ga0373953_0052455
352 Ga0373937_0142708
353 Ga0436364_1284771
354 Ga0436363_0997851
355 Ga0451791_1600159
356 Ga0451797_1189918
357 Ga0451807_0115278
358 Ga0451853_1859521
359 Ga0439446_0039973
360 Ga0439444_0130724
361 Ga0453684_0065251
362 Ga0466967_0342577
363 Ga0496110_0225027
364 Ga0501034_0304311
365 Ga0501034_0566831
366 Ga0501036_0076470
367 Ga0501036_0279653
368 Ga0501038_0166615
369 Ga0501039_0320264
370 Ga0501041_0108182
371 Ga0501046_0296260
372 Ga0501047_0055452
373 Ga0501047_0351552
374 Ga0501048_0112954
375 Ga0501067_0065909
376 Ga0501071_0016908
377 Ga0501071_0112336
378 Ga0501072_0041099
379 Ga0501076_0154840
380 Ga0501076_1197583
381 Ga0501077_0136307
382 Ga0501077_0151991
383 Ga0501079_0020956
384 Ga0501081_0265728
385 Ga0501272_065798
386 Ga0501045_0005071
387 Ga0501045_0055281
388 nmdc:mga00v17_61978_c1
389 nmdc:mga00v17_94244_c1
390 nmdc:mga06z11_203566_c1
391 nmdc:mga06z11_451628_c1
392 nmdc:mga04h51_139753_c1
393 nmdc:mga07m45_36034_c2
394 nmdc:mga07m45_43586_c1
395 nmdc:mga05p37_2518_c1
396 nmdc:mga05p37_52467_c1
397 nmdc:mga09592_219106_c1
398 nmdc:mga09592_41922_c1
399 nmdc:mga0qj67_5556_c1
400 nmdc:mga06r32_1359362_c1
401 nmdc:mga0a205_83874_c1
402 Ga0500641_0006164
403 Ga0501084_0021025
404 Ga0501084_0257407
405 Ga0501084_0476452
406 Ga0590075_060742
407 Ga0501082_0013278
408 Ga0501082_1518107
409 Ga0530510_0002025
410 Ga0530510_1459858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

4

86

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a1x-assembly1.cif.gz_F sodium pumping nadh-quinone oxidoreductase with inhibitor dqa 0.7945 2 90
6yj4-assembly1.cif.gz_G structure of yarrowia lipolytica complex i at 2.7 a 0.7907 2 88
8oh5-assembly1.cif.gz_C cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.7856 3 88
6zkf-assembly1.cif.gz_3 complex i during turnover, open3 0.7806 2 88
3zyy-assembly1.cif.gz_X reductive activator for corrinoid,iron-sulfur protein 0.7688 1 94
ID Description Score Start End Superfamily
af_Q2FVV9_5_125_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8133 3 90 3.10.20.740
af_P75863_271_368_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8039 2 87 3.10.20.30
af_P75824_230_322_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7888 1 87 3.10.20.30
af_P9WIV9_16_140_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7824 1 88 3.10.20.740
3zyyX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7797 1 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3M1G828-F1-model_v4 (2Fe-2S)-binding protein 1.002 17 116 GO:0051536
AF-A0A534E932-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 1.002 32 116 GO:0051536
AF-I0I186-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 1.001 1 116 GO:0051536
AF-A0A2E5K6L8-F1-model_v4 deleted 0.9948 1 116
AF-I0I186-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9926 1 116 GO:0051536

Map