F313292

General Info

Members Datasets Scaffolds Average Seq Length
205 138 410 159

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10011316|JGI25406J46586_100113163
Length 207
Sequence MSESEKQFLSFKLPPISLEAYLTPLLKAMKVITLTSHFIYTIMAEDLTIVTGNKTEQYESLIPQIKGLLDGEADLIANLXNIVAALKEQFKWLWVGFYLVKTASSADRNDELVLAPFQGPVACTRIRKGKGVCGTSWEQARTLIVPDVEKFPGHIACSSLSKSEIVVPVVRNNHVIAVLDVDSEEWNYFDETDQKFLEEIVELINFN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
107 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
134 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
135 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
136 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
137 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
138 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.34
Nodule 0
Rhizoplane 0.98
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011316 3300003203 Bacteria 3920
2 JGI24739J22299_10004960 3300001989 Bacteria 5065
3 rootH2_10045710 3300003320 Bacteria 24416
4 rootH2_10240241 3300003320 Bacteria 1216
5 rootH1_10297025 3300003323 Bacteria 3222
6 JGI25160J50197_1004848 3300003354 Bacteria 5729
7 Ga0055526_1020075 3300003771 Bacteria 2398
8 Ga0055528_1000312 3300003790 Bacteria 41028
9 Ga0055530_10000372 3300003791 Bacteria 40539
10 Ga0065165_1000056 3300005262 Bacteria 186730
11 Ga0065704_10201301 3300005289 Bacteria 1145
12 Ga0065712_10207646 3300005290 Bacteria 1084
13 Ga0070658_10000011 3300005327 Bacteria 294396
14 Ga0070658_10279333 3300005327 Bacteria 1421
15 Ga0070683_100003294 3300005329 Bacteria 13049
16 Ga0070670_100093456 3300005331 Unclassified 2586
17 Ga0070670_100122744 3300005331 Bacteria 2241
18 Ga0070670_100151113 3300005331 Bacteria 2010
19 Ga0070670_100220447 3300005331 Bacteria 1650
20 Ga0070670_101185476 3300005331 Unclassified 698
21 Ga0070677_10258475 3300005333 Bacteria 868
22 Ga0068869_100015600 3300005334 Bacteria 5102
23 Ga0068868_100479429 3300005338 Bacteria 1086
24 Ga0070660_100033990 3300005339 Bacteria 3848
25 Ga0070660_100258283 3300005339 Bacteria 1422
26 Ga0070660_100302312 3300005339 Bacteria 1312
27 Ga0070661_100305962 3300005344 Bacteria 1238
28 Ga0070692_10337654 3300005345 Bacteria 932
29 Ga0070668_100153865 3300005347 Bacteria 1862
30 Ga0070675_101428070 3300005354 Bacteria 638
31 Ga0070667_100677228 3300005367 Unclassified 953
32 Ga0070667_100729753 3300005367 Unclassified 918
33 Ga0070663_101518347 3300005455 Unclassified 596
34 Ga0070678_100632680 3300005456 Bacteria 958
35 Ga0070678_101486706 3300005456 Viruses 634
36 Ga0070681_10211872 3300005458 Bacteria 1853
37 Ga0068867_100022882 3300005459 Bacteria 4472
38 Ga0070679_100550299 3300005530 Bacteria 1098
39 Ga0070684_100134125 3300005535 Unclassified 2235
40 Ga0070672_100096839 3300005543 Bacteria 2388
41 Ga0070704_101532295 3300005549 Unclassified 614
42 Ga0068855_100023662 3300005563 Bacteria 7356
43 Ga0068855_100163103 3300005563 Bacteria 2528
44 Ga0068855_100402622 3300005563 Unclassified 1499
45 Ga0068855_100464680 3300005563 Unclassified 1379
46 Ga0068856_100003903 3300005614 Bacteria 14952
47 Ga0068852_100421564 3300005616 Bacteria 1316
48 Ga0068864_101706982 3300005618 Bacteria 634
49 Ga0068851_10249065 3300005834 Bacteria 1007
50 Ga0068860_100273003 3300005843 Bacteria 1651
51 Ga0068860_100332878 3300005843 Unclassified 1492
52 Ga0068862_100695801 3300005844 Unclassified 984
53 Ga0081539_10000696 3300005985 Bacteria 67397
54 Ga0097621_100031060 3300006237 Bacteria 4235
55 Ga0068871_100027769 3300006358 Bacteria 4429
56 Ga0075434_100110170 3300006871 Unclassified 2764
57 Ga0075429_100493371 3300006880 Bacteria 1073
58 Ga0105240_10000068 3300009093 Bacteria 207756
59 Ga0105240_10036280 3300009093 Bacteria 6344
60 Ga0111539_10354374 3300009094 Bacteria 1708
61 Ga0111539_10678243 3300009094 Bacteria 1200
62 Ga0105241_10047105 3300009174 Bacteria 3277
63 Ga0105242_10038842 3300009176 Bacteria 3830
64 Ga0105237_10000274 3300009545 Bacteria 72354
65 Ga0105237_10091472 3300009545 Bacteria 3032
66 Ga0105237_10196971 3300009545 Bacteria 2014
67 Ga0105237_10333948 3300009545 Bacteria 1520
68 Ga0105239_10000002 3300010375 Bacteria 610298
69 Ga0105239_10002065 3300010375 Bacteria 26034
70 Ga0105239_10218460 3300010375 Bacteria 2137
71 Ga0105239_10265905 3300010375 Bacteria 1928
72 Ga0105239_12591121 3300010375 Unclassified 591
73 Ga0105246_12108208 3300011119 Unclassified 546
74 Ga0157373_10000362 3300013100 Bacteria 36427
75 Ga0157373_10004567 3300013100 Bacteria 10413
76 Ga0157371_10009402 3300013102 Bacteria 7697
77 Ga0157371_10025916 3300013102 Unclassified 4266
78 Ga0157371_10415647 3300013102 Bacteria 985
79 Ga0157370_10114644 3300013104 Bacteria 2518
80 Ga0157370_10212572 3300013104 Bacteria 1792
81 Ga0157369_10809765 3300013105 Unclassified 962
82 Ga0157374_10077357 3300013296 Bacteria 3148
83 Ga0157378_10034250 3300013297 Bacteria 4491
84 Ga0157378_10334044 3300013297 Bacteria 1476
85 Ga0163162_10000266 3300013306 Bacteria 47442
86 Ga0163162_10441876 3300013306 Bacteria 1433
87 Ga0157372_10001733 3300013307 Bacteria 23656
88 Ga0157372_10015713 3300013307 Bacteria 8118
89 Ga0157372_10060830 3300013307 Bacteria 4226
90 Ga0157375_10064280 3300013308 Bacteria 3653
91 Ga0157375_10187876 3300013308 Bacteria 2220
92 Ga0163163_10974101 3300014325 Bacteria 911
93 Ga0157380_10008348 3300014326 Bacteria 7385
94 Ga0157379_10364694 3300014968 Bacteria 1324
95 Ga0157379_11030367 3300014968 Unclassified 786
96 Ga0157376_10669822 3300014969 Unclassified 1040
97 Ga0163161_10088942 3300017792 Bacteria 2283
98 Ga0163161_10149183 3300017792 Bacteria 1776
99 Ga0213876_10005470 3300021384 Bacteria 6978
100 Ga0209026_1001403 3300025250 Bacteria 10725
101 Ga0209026_1012637 3300025250 Bacteria 1464
102 Ga0209673_1000014 3300025273 Bacteria 537082
103 Ga0209564_1025570 3300025295 Bacteria 1979
104 Ga0209758_1011295 3300025297 Bacteria 5195
105 Ga0209050_1000838 3300025298 Bacteria 42361
106 Ga0207426_1016790 3300025302 Bacteria 2616
107 Ga0209051_1007130 3300025303 Bacteria 6166
108 Ga0209257_1001177 3300025304 Bacteria 33095
109 Ga0207705_10000015 3300025909 Bacteria 382901
110 Ga0207705_10094168 3300025909 Unclassified 2196
111 Ga0207705_10437846 3300025909 Bacteria 1013
112 Ga0207654_10029576 3300025911 Bacteria 3001
113 Ga0207707_10180341 3300025912 Bacteria 1844
114 Ga0207695_10000131 3300025913 Bacteria 223762
115 Ga0207695_10017401 3300025913 Bacteria 8365
116 Ga0207695_10152463 3300025913 Bacteria 2249
117 Ga0207671_10000993 3300025914 Bacteria 34894
118 Ga0207671_10058378 3300025914 Bacteria 2860
119 Ga0207671_10122899 3300025914 Bacteria 1985
120 Ga0207657_10054756 3300025919 Bacteria 3448
121 Ga0207657_10138058 3300025919 Bacteria 1993
122 Ga0207649_10363249 3300025920 Bacteria 1075
123 Ga0207652_10376724 3300025921 Bacteria 1281
124 Ga0207650_10248063 3300025925 Bacteria 1441
125 Ga0207650_10392527 3300025925 Bacteria 1147
126 Ga0207650_10533255 3300025925 Unclassified 983
127 Ga0207669_10425635 3300025937 Bacteria 1046
128 Ga0207691_10137079 3300025940 Bacteria 2158
129 Ga0207689_10012930 3300025942 Bacteria 7126
130 Ga0207661_10109160 3300025944 Bacteria 2337
131 Ga0207667_10043355 3300025949 Bacteria 4775
132 Ga0207667_10233439 3300025949 Bacteria 1883
133 Ga0207640_10336900 3300025981 Unclassified 1207
134 Ga0207658_10740041 3300025986 Unclassified 890
135 Ga0207658_11256436 3300025986 Unclassified 677
136 Ga0207677_10694381 3300026023 Unclassified 902
137 Ga0207639_10223223 3300026041 Bacteria 1629
138 Ga0207678_11446566 3300026067 Unclassified 607
139 Ga0207702_10008159 3300026078 Bacteria 8853
140 Ga0207702_11203468 3300026078 Unclassified 752
141 Ga0207648_10022946 3300026089 Bacteria 5596
142 Ga0207648_10053026 3300026089 Bacteria 3546
143 Ga0207683_10649108 3300026121 Bacteria 977
144 Ga0207683_11868075 3300026121 Viruses 549
145 Ga0268264_10031273 3300028381 Bacteria 4365
146 Ga0268264_10549869 3300028381 Unclassified 1132
147 Ga0307515_10066786 3300028794 Bacteria 4974
148 Ga0373934_0442976 3300035086 Bacteria 544
149 Ga0373941_0033780 3300035115 Bacteria 1539
150 Ga0395899_0209485 3300037312 Bacteria 1355
151 Ga0395899_0752217 3300037312 Unclassified 606
152 Ga0395900_0000330 3300037418 Bacteria 69819
153 Ga0395900_0079894 3300037418 Bacteria 3360
154 Ga0395900_0476849 3300037418 Bacteria 1200
155 Ga0395900_0557824 3300037418 Unclassified 1089
156 Ga0395900_1732862 3300037418 Unclassified 535
157 Ga0395898_0007001 3300037466 Bacteria 11983
158 Ga0395898_0049821 3300037466 Bacteria 4102
159 Ga0395898_0071218 3300037466 Unclassified 3360
160 Ga0395898_0839069 3300037466 Bacteria 858
161 Ga0395898_1343417 3300037466 Unclassified 643
162 Ga0395905_0005441 3300037471 Bacteria 13008
163 Ga0395905_0009969 3300037471 Bacteria 9258
164 Ga0395905_0044593 3300037471 Bacteria 4162
165 Ga0395905_0453129 3300037471 Bacteria 1181
166 Ga0395901_0240936 3300038443 Bacteria 1886
167 Ga0395901_1422554 3300038443 Unclassified 651
168 Ga0436365_1263568 3300039437 Bacteria 1232
169 Ga0436365_1429968 3300039437 Bacteria 11831
170 Ga0436365_1441614 3300039437 Unclassified 593
171 Ga0439453_0118676 3300041408 Unclassified 605
172 Ga0439441_005437 3300042001 Bacteria 1980
173 Ga0439457_092655 3300042014 Bacteria 700
174 Ga0439460_0074146 3300042461 Unclassified 1059
175 Ga0451577_0046369 3300042876 Bacteria 3889
176 Ga0466957_0946624 3300044842 Bacteria 617
177 Ga0466959_0464854 3300045049 Bacteria 857
178 Ga0495582_0430941 3300046473 Bacteria 761
179 Ga0495621_0238801 3300046539 Bacteria 740
180 Ga0495670_0093839 3300046691 Unclassified 1538
181 Ga0495672_0080279 3300047320 Bacteria 1820
182 Ga0496110_1078753 3300048913 Unclassified 711
183 Ga0496113_1134134 3300048916 Unclassified 612
184 Ga0501032_0403478 3300049569 Bacteria 878
185 Ga0501033_0012835 3300049570 Bacteria 6389
186 Ga0501034_0003741 3300049571 Bacteria 17186
187 Ga0501034_0293490 3300049571 Bacteria 1563
188 Ga0501037_0002106 3300049573 Bacteria 14423
189 Ga0501037_0229154 3300049573 Unclassified 1305
190 Ga0501038_0014847 3300049574 Bacteria 7093
191 Ga0501039_0083926 3300049575 Bacteria 2481
192 Ga0501043_0148590 3300049579 Bacteria 1834
193 Ga0501047_0879856 3300049581 Unclassified 709
194 Ga0501253_128316 3300049683 Unclassified 621
195 Ga0501035_0022258 3300049822 Bacteria 5820
196 Ga0501044_0003545 3300049823 Bacteria 17566
197 nmdc:mga0k408_293106_c1 3300050493 Bacteria 971
198 nmdc:mga08y16_1068206_c1 3300050511 Unclassified 784
199 nmdc:mga0n895_107067_c1 3300050512 Unclassified 2809
200 2819679858 2818991460 Bacteria 7595395
201 2852623641 2852623160 Bacteria 4376875
202 2884937456 2884933994 Bacteria 4535041
203 2929180032 2929177148 Bacteria 7883697
204 2945982458 2945977869 Bacteria 7777518
205 2946018159 2946013367 Bacteria 7766675
206 JGI25406J46586_10011316
207 JGI24739J22299_10004960
208 rootH2_10045710
209 rootH2_10240241
210 rootH1_10297025
211 JGI25160J50197_1004848
212 Ga0055526_1020075
213 Ga0055528_1000312
214 Ga0055530_10000372
215 Ga0065165_1000056
216 Ga0065704_10201301
217 Ga0065712_10207646
218 Ga0070658_10000011
219 Ga0070658_10279333
220 Ga0070683_100003294
221 Ga0070670_100093456
222 Ga0070670_100122744
223 Ga0070670_100151113
224 Ga0070670_100220447
225 Ga0070670_101185476
226 Ga0070677_10258475
227 Ga0068869_100015600
228 Ga0068868_100479429
229 Ga0070660_100033990
230 Ga0070660_100258283
231 Ga0070660_100302312
232 Ga0070661_100305962
233 Ga0070692_10337654
234 Ga0070668_100153865
235 Ga0070675_101428070
236 Ga0070667_100677228
237 Ga0070667_100729753
238 Ga0070663_101518347
239 Ga0070678_100632680
240 Ga0070678_101486706
241 Ga0070681_10211872
242 Ga0068867_100022882
243 Ga0070679_100550299
244 Ga0070684_100134125
245 Ga0070672_100096839
246 Ga0070704_101532295
247 Ga0068855_100023662
248 Ga0068855_100163103
249 Ga0068855_100402622
250 Ga0068855_100464680
251 Ga0068856_100003903
252 Ga0068852_100421564
253 Ga0068864_101706982
254 Ga0068851_10249065
255 Ga0068860_100273003
256 Ga0068860_100332878
257 Ga0068862_100695801
258 Ga0081539_10000696
259 Ga0097621_100031060
260 Ga0068871_100027769
261 Ga0075434_100110170
262 Ga0075429_100493371
263 Ga0105240_10000068
264 Ga0105240_10036280
265 Ga0111539_10354374
266 Ga0111539_10678243
267 Ga0105241_10047105
268 Ga0105242_10038842
269 Ga0105237_10000274
270 Ga0105237_10091472
271 Ga0105237_10196971
272 Ga0105237_10333948
273 Ga0105239_10000002
274 Ga0105239_10002065
275 Ga0105239_10218460
276 Ga0105239_10265905
277 Ga0105239_12591121
278 Ga0105246_12108208
279 Ga0157373_10000362
280 Ga0157373_10004567
281 Ga0157371_10009402
282 Ga0157371_10025916
283 Ga0157371_10415647
284 Ga0157370_10114644
285 Ga0157370_10212572
286 Ga0157369_10809765
287 Ga0157374_10077357
288 Ga0157378_10034250
289 Ga0157378_10334044
290 Ga0163162_10000266
291 Ga0163162_10441876
292 Ga0157372_10001733
293 Ga0157372_10015713
294 Ga0157372_10060830
295 Ga0157375_10064280
296 Ga0157375_10187876
297 Ga0163163_10974101
298 Ga0157380_10008348
299 Ga0157379_10364694
300 Ga0157379_11030367
301 Ga0157376_10669822
302 Ga0163161_10088942
303 Ga0163161_10149183
304 Ga0213876_10005470
305 Ga0209026_1001403
306 Ga0209026_1012637
307 Ga0209673_1000014
308 Ga0209564_1025570
309 Ga0209758_1011295
310 Ga0209050_1000838
311 Ga0207426_1016790
312 Ga0209051_1007130
313 Ga0209257_1001177
314 Ga0207705_10000015
315 Ga0207705_10094168
316 Ga0207705_10437846
317 Ga0207654_10029576
318 Ga0207707_10180341
319 Ga0207695_10000131
320 Ga0207695_10017401
321 Ga0207695_10152463
322 Ga0207671_10000993
323 Ga0207671_10058378
324 Ga0207671_10122899
325 Ga0207657_10054756
326 Ga0207657_10138058
327 Ga0207649_10363249
328 Ga0207652_10376724
329 Ga0207650_10248063
330 Ga0207650_10392527
331 Ga0207650_10533255
332 Ga0207669_10425635
333 Ga0207691_10137079
334 Ga0207689_10012930
335 Ga0207661_10109160
336 Ga0207667_10043355
337 Ga0207667_10233439
338 Ga0207640_10336900
339 Ga0207658_10740041
340 Ga0207658_11256436
341 Ga0207677_10694381
342 Ga0207639_10223223
343 Ga0207678_11446566
344 Ga0207702_10008159
345 Ga0207702_11203468
346 Ga0207648_10022946
347 Ga0207648_10053026
348 Ga0207683_10649108
349 Ga0207683_11868075
350 Ga0268264_10031273
351 Ga0268264_10549869
352 Ga0307515_10066786
353 Ga0373934_0442976
354 Ga0373941_0033780
355 Ga0395899_0209485
356 Ga0395899_0752217
357 Ga0395900_0000330
358 Ga0395900_0079894
359 Ga0395900_0476849
360 Ga0395900_0557824
361 Ga0395900_1732862
362 Ga0395898_0007001
363 Ga0395898_0049821
364 Ga0395898_0071218
365 Ga0395898_0839069
366 Ga0395898_1343417
367 Ga0395905_0005441
368 Ga0395905_0009969
369 Ga0395905_0044593
370 Ga0395905_0453129
371 Ga0395901_0240936
372 Ga0395901_1422554
373 Ga0436365_1263568
374 Ga0436365_1429968
375 Ga0436365_1441614
376 Ga0439453_0118676
377 Ga0439441_005437
378 Ga0439457_092655
379 Ga0439460_0074146
380 Ga0451577_0046369
381 Ga0466957_0946624
382 Ga0466959_0464854
383 Ga0495582_0430941
384 Ga0495621_0238801
385 Ga0495670_0093839
386 Ga0495672_0080279
387 Ga0496110_1078753
388 Ga0496113_1134134
389 Ga0501032_0403478
390 Ga0501033_0012835
391 Ga0501034_0003741
392 Ga0501034_0293490
393 Ga0501037_0002106
394 Ga0501037_0229154
395 Ga0501038_0014847
396 Ga0501039_0083926
397 Ga0501043_0148590
398 Ga0501047_0879856
399 Ga0501253_128316
400 Ga0501035_0022258
401 Ga0501044_0003545
402 nmdc:mga0k408_293106_c1
403 nmdc:mga08y16_1068206_c1
404 nmdc:mga0n895_107067_c1
405 2819679858
406 2852623641
407 2884937456
408 2929180032
409 2945982458
410 2946018159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

74

207

0.87

PF13185

GAF_2

GAF domain

72

207

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9826 5 156
3rfb-assembly1.cif.gz_A structure of frmsr 0.9654 10 155
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9648 10 156
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9461 11 156
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9457 5 156
ID Description Score Start End Superfamily
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9786 3 157 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9663 3 157 3.30.450.40
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9654 10 155 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.953 11 155 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9461 11 156 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A8B5WII8-F1-model_v4 GAF domain-containing protein 0.9965 50 154 GO:0005829
GO:0033745
AF-A0A520DHR9-F1-model_v4 GAF domain-containing protein 0.9929 16 155 GO:0005829
GO:0033745
AF-A0A7C7CXV8-F1-model_v4 GAF domain-containing protein 0.9928 50 154 GO:0005829
GO:0033745
AF-A0A4Q3D6Q4-F1-model_v4 GAF domain-containing protein 0.9919 32 157 GO:0005829
GO:0033745
AF-A0A7Y2TF96-F1-model_v4 GAF domain-containing protein 0.9906 38 155 GO:0005829
GO:0033745

Map