F313199

General Info

Members Datasets Scaffolds Average Seq Length
204 160 121 424

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885526491|2885527991
Length 454
Sequence DKENHPAYLASRTEPKRRAIMLQIIKNANILNQQGELERKTIIIDEGKIQKIAGVEDEAVLKAEQSAHSVTDASGKLVIPGLIDMHVHLREPGFEHKETIETGARSAAQGGFTTIACMPNTRPVTDSADVVKLVLDKAKEADLVKVLPYAAITKNELGRELTDFAALKEAGAIGFTDDGVGVQNAQMMKDAMNLAASMDMPVIAHCEDDSLVVGGYVTEGEFSKRHGIKGIPNESEAIHVGRDILLAEATGVHYHVCHVSTEQSVRLIRLAKSIGIKVTAEVCPHHLVLSDEDIPGMDANWKMNPPLRSPRDVQACIEGLLDGTLDMIVTDHAPHSEEEKAKGMELAPFGIVGFETAFPLLYTKFVETGLWSLDFLVKRMTADPARVFRLDTGKLEEGAPADITMIDLNEEKAVDPATFATKGRNTPFTGWKLKGWATQTWVDGKSVWNNTVQQ

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
4 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
5 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
6 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
7 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
8 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
9 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
10 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
11 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
12 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
13 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
14 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
15 2671180694 Paenibacillus sp. A3 Isolate Unclassified
16 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
17 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
18 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
19 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
20 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
21 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
22 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
23 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
24 2818991459 Paenibacillus sp. 597 Isolate Unclassified
25 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
26 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
27 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
28 2857472729 Cohnella sp. R-74144 Isolate Unclassified
29 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
30 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
31 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
32 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
33 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
34 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
35 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
36 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
37 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
38 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
39 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
40 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
41 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
42 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
43 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
44 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
45 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
46 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
47 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
48 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
49 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
50 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
51 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
52 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
53 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
54 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
55 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
56 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
57 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
58 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
59 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
60 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
61 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
62 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
63 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
64 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
65 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
66 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
67 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
68 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
69 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
70 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
71 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
72 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
73 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
152 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
153 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
154 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
155 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
156 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
157 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
158 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
159 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
160 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 58.33
Metatranscriptomes 0.98
Isolates 40.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 13.73
Nodule 0.49
Rhizoplane 1.47
Rhizosphere 51.47
Stem 0
Stem Tuber 0
Unclassified 32.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009195 3300001979 Bacteria 3884
2 JGI25151J46595_10006269 3300003187 Bacteria 6005
3 JGI25165J46597_1001557 3300003214 Bacteria 11362
4 rootH1_10024899 3300003323 Bacteria 34477
5 rootH1_10123823 3300003323 Bacteria 3391
6 rootH1_10172140 3300003323 Bacteria 3546
7 Ga0055538_1000554 3300003751 Bacteria 12905
8 Ga0055538_1000666 3300003751 Bacteria 10756
9 Ga0055538_1000748 3300003751 Bacteria 9391
10 Ga0055535_1002889 3300003761 Bacteria 5368
11 Ga0070663_100044003 3300005455 Bacteria 3145
12 Ga0070684_100137921 3300005535 Bacteria 2204
13 Ga0068855_100009826 3300005563 Bacteria 11542
14 Ga0068856_100000015 3300005614 Bacteria 157353
15 Ga0068856_100287112 3300005614 Bacteria 1662
16 Ga0075366_10002120 3300006195 Bacteria 10089
17 Ga0075366_10009582 3300006195 Bacteria 5410
18 Ga0105244_10003880 3300009036 Bacteria 10515
19 Ga0105240_10340592 3300009093 Bacteria 1704
20 Ga0105240_10433078 3300009093 Bacteria 1475
21 Ga0105237_10000717 3300009545 Bacteria 45892
22 Ga0105237_10004898 3300009545 Bacteria 15327
23 Ga0105237_10008568 3300009545 Bacteria 11059
24 Ga0105239_10000010 3300010375 Bacteria 341545
25 Ga0157373_10000013 3300013100 Bacteria 186870
26 Ga0157371_10001612 3300013102 Bacteria 23130
27 Ga0157369_10003409 3300013105 Bacteria 18845
28 Ga0157372_10000010 3300013307 Bacteria 300658
29 Ga0157372_10025618 3300013307 Bacteria 6417
30 Ga0209784_100089 3300025224 Bacteria 119510
31 Ga0209784_100401 3300025224 Bacteria 19661
32 Ga0209566_100058 3300025225 Bacteria 201317
33 Ga0209566_100184 3300025225 Bacteria 66408
34 Ga0209566_100393 3300025225 Bacteria 35266
35 Ga0207427_100085 3300025231 Bacteria 142561
36 Ga0209437_100052 3300025233 Bacteria 380548
37 Ga0209437_100562 3300025233 Bacteria 24419
38 Ga0209258_102740 3300025242 Bacteria 4279
39 Ga0209233_1000067 3300025261 Bacteria 380554
40 Ga0209675_1015898 3300025291 Bacteria 2214
41 Ga0209676_1000974 3300025292 Bacteria 34458
42 Ga0209025_1001462 3300025294 Bacteria 30897
43 Ga0209025_1002087 3300025294 Bacteria 22592
44 Ga0209025_1009503 3300025294 Bacteria 6758
45 Ga0209025_1012762 3300025294 Bacteria 5350
46 Ga0209025_1013992 3300025294 Bacteria 4989
47 Ga0207705_10000052 3300025909 Bacteria 168319
48 Ga0207671_10003566 3300025914 Bacteria 15409
49 Ga0207671_10008656 3300025914 Bacteria 8591
50 Ga0207671_10029531 3300025914 Bacteria 4094
51 Ga0207667_10021412 3300025949 Bacteria 7165
52 Ga0207678_10003893 3300026067 Bacteria 13425
53 Ga0207702_10002568 3300026078 Bacteria 17064
54 Ga0265318_10002123 3300028577 Bacteria 10791
55 Ga0265330_10008793 3300031235 Bacteria 4837
56 Ga0265332_10005936 3300031238 Bacteria 5585
57 Ga0265320_10009008 3300031240 Bacteria 6052
58 Ga0265339_10020768 3300031249 Bacteria 3831
59 Ga0265331_10005937 3300031250 Bacteria 7295
60 Ga0265316_10005163 3300031344 Bacteria 12785
61 Ga0265314_10064535 3300031711 Unclassified 2478
62 Ga0265342_10003287 3300031712 Bacteria 13383
63 Ga0395899_0001366 3300037312 Bacteria 20911
64 Ga0395899_0060074 3300037312 Bacteria 2801
65 Ga0395899_0161665 3300037312 Bacteria 1581
66 Ga0436361_0199837 3300039447 Bacteria 14699
67 Ga0439436_0001357 3300041404 Bacteria 7047
68 Ga0439433_0016314 3300041999 Bacteria 1645
69 Ga0439449_0000098 3300042007 Bacteria 27750
70 Ga0439449_0003617 3300042007 Bacteria 5999
71 Ga0439462_0001463 3300042015 Bacteria 5269
72 Ga0466969_0005687 3300044656 Bacteria 6628
73 Ga0466969_0029849 3300044656 Bacteria 2782
74 Ga0466966_0020113 3300044684 Bacteria 4392
75 Ga0466961_0051481 3300044693 Bacteria 2630
76 Ga0466957_0079074 3300044842 Bacteria 2046
77 Ga0466959_0002253 3300045049 Bacteria 12292
78 Ga0466958_0043084 3300045836 Bacteria 2718
79 Ga0495606_0015583 3300046507 Bacteria 5847
80 Ga0495606_0034021 3300046507 Bacteria 3505
81 Ga0495661_0009723 3300046665 Bacteria 6587
82 Ga0495660_0024743 3300046810 Bacteria 3419
83 Ga0495660_0050412 3300046810 Bacteria 2268
84 Ga0496108_0000195 3300048911 Bacteria 56492
85 Ga0496110_0052295 3300048913 Bacteria 3590
86 Ga0496116_0004056 3300048919 Bacteria 14158
87 Ga0496116_0019626 3300048919 Bacteria 5170
88 Ga0496116_0037590 3300048919 Bacteria 3373
89 Ga0496116_0040370 3300048919 Bacteria 3214
90 Ga0496116_0060048 3300048919 Bacteria 2468
91 Ga0496116_0131722 3300048919 Bacteria 1424
92 Ga0496117_0018307 3300048920 Bacteria 5808
93 Ga0496119_0004374 3300048922 Bacteria 14102
94 Ga0496119_0004929 3300048922 Bacteria 13050
95 Ga0496120_0000215 3300048923 Bacteria 99455
96 Ga0496120_0016485 3300048923 Bacteria 4830
97 Ga0496122_0002091 3300048925 Bacteria 29584
98 Ga0496122_0033569 3300048925 Bacteria 4218
99 Ga0496122_0039662 3300048925 Bacteria 3753
100 Ga0496122_0104537 3300048925 Bacteria 1881
101 Ga0496123_0080692 3300048926 Bacteria 1981
102 Ga0496124_0000368 3300048927 Bacteria 82338
103 Ga0496124_0001059 3300048927 Bacteria 43414
104 Ga0496124_0058206 3300048927 Bacteria 3252
105 Ga0496124_0093490 3300048927 Bacteria 2447
106 Ga0496125_0001336 3300048928 Bacteria 36363
107 Ga0496125_0001763 3300048928 Bacteria 30006
108 Ga0496125_0006318 3300048928 Bacteria 12858
109 Ga0496126_0000749 3300048929 Bacteria 58862
110 Ga0496126_0005813 3300048929 Bacteria 13942
111 Ga0496126_0024846 3300048929 Bacteria 5777
112 Ga0501306_000922 3300049127 Bacteria 2533
113 Ga0501309_002992 3300049129 Bacteria 1880
114 Ga0501040_0038825 3300049576 Bacteria 3237
115 Ga0501042_0048446 3300049578 Bacteria 3030
116 Ga0501071_0022960 3300049587 Bacteria 4353
117 Ga0501072_0046928 3300049588 Bacteria 3401
118 nmdc:mga0k408_1396_c1 3300050493 Bacteria 13055
119 nmdc:mga0a205_13282_c1 3300050515 Bacteria 7309
120 Ga0500608_000903 3300053122 Bacteria 10695
121 Ga0500622_0009178 3300053156 Bacteria 5488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0131722 Ga0496116_0131722_14_1126 361
2 3300044842 Ga0466957_0079074 Ga0466957_0079074_851_2020 381
3 3300037312 Ga0395899_0161665 Ga0395899_0161665_246_1460 391
4 3300028577 Ga0265318_10002123 Ga0265318_100021238 392
5 3300031238 Ga0265332_10005936 Ga0265332_100059364 392
6 3300031240 Ga0265320_10009008 Ga0265320_100090084 392
7 3300031250 Ga0265331_10005937 Ga0265331_100059372 392
8 3300031344 Ga0265316_10005163 Ga0265316_100051634 392
9 3300031711 Ga0265314_10064535 Ga0265314_100645352 392
10 3300031712 Ga0265342_10003287 Ga0265342_100032874 392
11 3300044656 Ga0466969_0005687 Ga0466969_0005687_3803_5023 393
12 3300045049 Ga0466959_0002253 Ga0466959_0002253_7844_9064 393
13 3300049576 Ga0501040_0038825 Ga0501040_0038825_403_1698 401
14 3300049587 Ga0501071_0022960 Ga0501071_0022960_1155_2450 401
15 3300049588 Ga0501072_0046928 Ga0501072_0046928_461_1756 401
16 3300046810 Ga0495660_0024743 Ga0495660_0024743_1157_2431 404
17 3300009545 Ga0105237_10008568 Ga0105237_100085686 407
18 3300025914 Ga0207671_10029531 Ga0207671_100295315 407
19 3300048913 Ga0496110_0052295 Ga0496110_0052295_1048_2544 407
20 iso_pu_bacteria 2548877040 2550906272 407
21 iso_pu_bacteria 2571042143 2571532083 407
22 iso_pu_bacteria 2728368933 2728534265 407
23 iso_pu_bacteria 2881636855 2881640904 407
24 iso_pu_bacteria 2938649242 2938650164 407
25 iso_pu_bacteria 2968558590 2968564023 407
26 iso_pu_bacteria 2971403814 2971407208 407
27 iso_pu_bacteria 2988225383 2988228572 407
28 iso_pu_bacteria 2996632988 2996635954 407
29 iso_pu_bacteria 8054465665 8054470182 407
30 iso_pu_bacteria 8057733483 8057737647 407
31 3300031235 Ga0265330_10008793 Ga0265330_100087934 408
32 3300031249 Ga0265339_10020768 Ga0265339_100207681 408
33 iso_pu_bacteria 2907202186 2907205747 408
34 iso_pu_bacteria 2563366752 2563927012 409
35 iso_pu_bacteria 2571042588 2573037531 409
36 iso_pu_bacteria 2576861424 2578337980 409
37 iso_pu_bacteria 2579778775 2580933085 409
38 iso_pu_bacteria 2585428059 2587737849 409
39 iso_pu_bacteria 2619619294 2621276352 409
40 iso_pu_bacteria 2643221676 2644423064 409
41 iso_pu_bacteria 2818991459 2819670491 409
42 iso_pu_bacteria 2857453340 2857459405 409
43 iso_pu_bacteria 2864997549 2864999909 409
44 iso_pu_bacteria 2889295896 2889296169 409
45 iso_pu_bacteria 2904755435 2904760140 409
46 iso_pu_bacteria 2919425241 2919427204 409
47 iso_pu_bacteria 2971410472 2971417252 409
48 iso_pu_bacteria 2971511577 2971512578 409
49 iso_pu_bacteria 2980176882 2980178227 409
50 iso_pu_bacteria 2981284811 2981287912 409
51 iso_pu_bacteria 2981289755 2981292375 409
52 iso_pu_bacteria 2981980479 2981983531 409
53 iso_pu_bacteria 2981985349 2981988431 409
54 3300005614 Ga0068856_100287112 Ga0068856_1002871122 410
55 3300009093 Ga0105240_10340592 Ga0105240_103405922 410
56 3300009545 Ga0105237_10000717 Ga0105237_100007177 410
57 3300010375 Ga0105239_10000010 Ga0105239_10000010251 410
58 3300025914 Ga0207671_10008656 Ga0207671_100086562 410
59 3300048919 Ga0496116_0037590 Ga0496116_0037590_1534_2856 410
60 3300048922 Ga0496119_0004374 Ga0496119_0004374_8562_9884 410
61 3300048923 Ga0496120_0016485 Ga0496120_0016485_648_1970 410
62 3300048928 Ga0496125_0001763 Ga0496125_0001763_18929_20251 410
63 3300048929 Ga0496126_0024846 Ga0496126_0024846_1466_2788 410
64 iso_pu_bacteria 2593339198 2595316503 410
65 iso_pu_bacteria 2671180694 2673821813 410
66 iso_pu_bacteria 2744054657 2745169044 410
67 iso_pu_bacteria 2816332336 2817619636 410
68 iso_pu_bacteria 2980125574 2980125776 410
69 iso_pu_bacteria 2980182181 2980184460 410
70 iso_pu_bacteria 8055632911 8055635099 410
71 3300003761 Ga0055535_1002889 Ga0055535_10028896 411
72 3300025225 Ga0209566_100058 Ga0209566_100058145 411
73 3300025242 Ga0209258_102740 Ga0209258_1027404 411
74 3300025294 Ga0209025_1012762 Ga0209025_10127622 411
75 3300025294 Ga0209025_1013992 Ga0209025_10139926 411
76 3300049578 Ga0501042_0048446 Ga0501042_0048446_978_2303 411
77 iso_pu_bacteria 2512564039 2512734859 411
78 iso_pu_bacteria 2524023129 2524186547 411
79 iso_pu_bacteria 2600255286 2601639086 411
80 iso_pu_bacteria 2788500588 2791212238 411
81 iso_pu_bacteria 2818991451 2819625852 411
82 iso_pu_bacteria 2865002811 2865003494 411
83 iso_pu_bacteria 2888578766 2888580977 411
84 iso_pu_bacteria 2889049205 2889050340 411
85 iso_pu_bacteria 2904113452 2904114804 411
86 iso_pu_bacteria 2904606771 2904608255 411
87 iso_pu_bacteria 2925326138 2925326929 411
88 iso_pu_bacteria 2939593269 2939593686 411
89 iso_pu_bacteria 8054795415 8054798093 411
90 iso_pu_bacteria 8055531788 8055532933 411
91 iso_pu_bacteria 8057473075 8057473784 411
92 iso_pu_bacteria 8057473075 8057476234 411
93 iso_pu_bacteria 8057977335 8057979081 412
94 3300025225 Ga0209566_100393 Ga0209566_10039312 413
95 3300025291 Ga0209675_1015898 Ga0209675_10158982 413
96 3300025294 Ga0209025_1009503 Ga0209025_10095032 413
97 3300037312 Ga0395899_0060074 Ga0395899_0060074_855_2135 413
98 3300050515 nmdc:mga0a205_13282_c1 nmdc:mga0a205_13282_c1_287_1765 413
99 iso_pu_bacteria 2643221543 2643738050 413
100 iso_pu_bacteria 2751185905 2753810999 413
101 iso_pu_bacteria 2802428803 2802437268 413
102 iso_pu_bacteria 2821111986 2821114651 413
103 iso_pu_bacteria 2852623160 2852623797 413
104 iso_pu_bacteria 2864733723 2864735408 413
105 iso_pu_bacteria 2884933994 2884937298 413
106 iso_pu_bacteria 2889042446 2889046809 413
107 iso_pu_bacteria 2889276214 2889280866 413
108 iso_pu_bacteria 2904162308 2904163218 413
109 iso_pu_bacteria 2904490793 2904493715 413
110 iso_pu_bacteria 2904595352 2904598355 413
111 iso_pu_bacteria 2919160200 2919162795 413
112 iso_pu_bacteria 2929206907 2929210553 413
113 iso_pu_bacteria 2931384279 2931390257 413
114 iso_pu_bacteria 2939679117 2939679723 413
115 iso_pu_bacteria 2939702853 2939704612 413
116 iso_pu_bacteria 2945991243 2945997518 413
117 iso_pu_bacteria 2946053406 2946053729 413
118 iso_pu_bacteria 2977232053 2977233921 413
119 iso_pu_bacteria 2984532647 2984536430 413
120 iso_pu_bacteria 648028048 648171023 413
121 3300048920 Ga0496117_0018307 Ga0496117_0018307_2922_4208 414
122 3300048922 Ga0496119_0004929 Ga0496119_0004929_4245_5531 414
123 3300048923 Ga0496120_0000215 Ga0496120_0000215_31271_32557 414
124 3300048925 Ga0496122_0039662 Ga0496122_0039662_1718_3010 414
125 3300048925 Ga0496122_0104537 Ga0496122_0104537_448_1734 414
126 3300048926 Ga0496123_0080692 Ga0496123_0080692_388_1674 414
127 3300048927 Ga0496124_0000368 Ga0496124_0000368_63768_65054 414
128 3300048929 Ga0496126_0000749 Ga0496126_0000749_1867_3153 414
129 3300048929 Ga0496126_0005813 Ga0496126_0005813_10917_12209 414
130 iso_pu_bacteria 2791355222 2793184649 414
131 iso_pu_bacteria 2857472729 2857473506 414
132 3300003187 JGI25151J46595_10006269 JGI25151J46595_100062691 415
133 3300003751 Ga0055538_1000666 Ga0055538_10006669 415
134 3300003751 Ga0055538_1000748 Ga0055538_10007483 415
135 3300025224 Ga0209784_100089 Ga0209784_100089117 415
136 3300025292 Ga0209676_1000974 Ga0209676_10009742 415
137 3300025294 Ga0209025_1001462 Ga0209025_100146217 415
138 3300025294 Ga0209025_1002087 Ga0209025_100208719 415
139 3300041404 Ga0439436_0001357 Ga0439436_0001357_5118_6404 415
140 3300041999 Ga0439433_0016314 Ga0439433_0016314_217_1503 415
141 3300042007 Ga0439449_0000098 Ga0439449_0000098_13235_14521 415
142 3300042015 Ga0439462_0001463 Ga0439462_0001463_2460_3746 415
143 iso_pu_bacteria 8002317523 8002323240 415
144 iso_pu_bacteria 8046991243 8046997638 415
145 3300005614 Ga0068856_100000015 Ga0068856_1000000152 416
146 3300006195 Ga0075366_10002120 Ga0075366_100021206 416
147 3300006195 Ga0075366_10009582 Ga0075366_100095822 416
148 3300026078 Ga0207702_10002568 Ga0207702_100025682 416
149 3300042007 Ga0439449_0003617 Ga0439449_0003617_487_1776 416
150 3300046507 Ga0495606_0015583 Ga0495606_0015583_817_2067 416
151 3300046810 Ga0495660_0050412 Ga0495660_0050412_177_1427 416
152 3300049127 Ga0501306_000922 Ga0501306_000922_308_1597 416
153 3300049129 Ga0501309_002992 Ga0501309_002992_409_1698 416
154 3300050493 nmdc:mga0k408_1396_c1 nmdc:mga0k408_1396_c1_7878_9128 416
155 3300053156 Ga0500622_0009178 Ga0500622_0009178_2878_4128 416
156 3300003214 JGI25165J46597_1001557 JGI25165J46597_10015572 417
157 3300003323 rootH1_10024899 rootH1_1002489931 417
158 3300003323 rootH1_10123823 rootH1_101238232 417
159 3300003323 rootH1_10172140 rootH1_101721402 417
160 3300003751 Ga0055538_1000554 Ga0055538_10005545 417
161 3300005535 Ga0070684_100137921 Ga0070684_1001379212 417
162 3300005563 Ga0068855_100009826 Ga0068855_1000098268 417
163 3300009036 Ga0105244_10003880 Ga0105244_100038806 417
164 3300009093 Ga0105240_10433078 Ga0105240_104330781 417
165 3300009545 Ga0105237_10004898 Ga0105237_1000489813 417
166 3300013100 Ga0157373_10000013 Ga0157373_100000139 417
167 3300013307 Ga0157372_10025618 Ga0157372_100256184 417
168 3300025224 Ga0209784_100401 Ga0209784_10040111 417
169 3300025231 Ga0207427_100085 Ga0207427_10008560 417
170 3300025233 Ga0209437_100052 Ga0209437_100052184 417
171 3300025233 Ga0209437_100562 Ga0209437_10056215 417
172 3300025261 Ga0209233_1000067 Ga0209233_1000067184 417
173 3300025909 Ga0207705_10000052 Ga0207705_1000005280 417
174 3300025914 Ga0207671_10003566 Ga0207671_100035663 417
175 3300025949 Ga0207667_10021412 Ga0207667_100214126 417
176 3300039447 Ga0436361_0199837 Ga0436361_0199837_7783_9036 417
177 3300046665 Ga0495661_0009723 Ga0495661_0009723_3272_4525 417
178 3300048911 Ga0496108_0000195 Ga0496108_0000195_3788_5284 417
179 3300048919 Ga0496116_0004056 Ga0496116_0004056_11909_13213 417
180 3300048919 Ga0496116_0040370 Ga0496116_0040370_127_1431 417
181 3300048925 Ga0496122_0002091 Ga0496122_0002091_25453_26757 417
182 3300048925 Ga0496122_0033569 Ga0496122_0033569_1423_2727 417
183 3300048927 Ga0496124_0093490 Ga0496124_0093490_906_2210 417
184 3300048928 Ga0496125_0006318 Ga0496125_0006318_1537_2841 417
185 3300053122 Ga0500608_000903 Ga0500608_000903_2162_3415 417
186 iso_pu_bacteria 2885526491 2885527991 417
187 3300025225 Ga0209566_100184 Ga0209566_10018420 418
188 3300048919 Ga0496116_0019626 Ga0496116_0019626_1222_2526 418
189 3300048919 Ga0496116_0060048 Ga0496116_0060048_89_1384 418
190 3300048927 Ga0496124_0001059 Ga0496124_0001059_5971_7266 418
191 3300048927 Ga0496124_0058206 Ga0496124_0058206_1620_2924 418
192 3300048928 Ga0496125_0001336 Ga0496125_0001336_8706_10001 418
193 3300001979 JGI24740J21852_10009195 JGI24740J21852_100091955 419
194 3300005455 Ga0070663_100044003 Ga0070663_1000440032 419
195 3300013102 Ga0157371_10001612 Ga0157371_100016125 419
196 3300013105 Ga0157369_10003409 Ga0157369_100034097 419
197 3300013307 Ga0157372_10000010 Ga0157372_10000010237 419
198 3300026067 Ga0207678_10003893 Ga0207678_100038934 419
199 3300037312 Ga0395899_0001366 Ga0395899_0001366_6111_7370 419
200 3300044656 Ga0466969_0029849 Ga0466969_0029849_214_1473 419
201 3300044684 Ga0466966_0020113 Ga0466966_0020113_1635_2894 419
202 3300044693 Ga0466961_0051481 Ga0466961_0051481_379_1638 419
203 3300045836 Ga0466958_0043084 Ga0466958_0043084_852_2111 419
204 3300046507 Ga0495606_0034021 Ga0495606_0034021_1944_3203 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12890

DHOase

Dihydro-orotase-like

75

264

0.92

PF01979

Amidohydro_1

Amidohydrolase family

77

447

0.9

PF07969

Amidohydro_3

Amidohydrolase family

366

448

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bjh-assembly1.cif.gz_A crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) 0.9577 2 416
4yiw-assembly1.cif.gz_A dihydroorotase from bacillus anthracis with substrate bound 0.9565 3 419
2z00-assembly1.cif.gz_A crystal structure of dihydroorotase from thermus thermophilus 0.9564 3 408
3d6n-assembly1.cif.gz_A crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase 0.9548 2 416
4yiw-assembly1.cif.gz_A dihydroorotase from bacillus anthracis with substrate bound 0.9499 3 419
ID Description Score Start End Superfamily
af_P9WHL3_52_363_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9875 55 358 3.20.20.140
4bjhA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9728 55 360 3.20.20.140
2z00A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9703 55 360 3.20.20.140
af_P9WHL3_52_363_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9593 55 358 3.20.20.140
4bjhA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9574 55 360 3.20.20.140
ID Description Score Start End GO Terms
AF-X1RPE8-F1-model_v4 Dihydroorotase 0.9938 180 283 GO:0004038
GO:0005737
GO:0006145
AF-A0A4U9JXN2-F1-model_v4 deleted 0.9919 192 417
AF-A0A4Q5SDY6-F1-model_v4 Dihydroorotase 0.9914 263 416 GO:0004038
GO:0005737
GO:0006145
AF-A0A3D3PEW1-F1-model_v4 Dihydroorotase 0.9912 234 416 GO:0004038
GO:0005737
GO:0006145
AF-A0A2G4H9I9-F1-model_v4 Dihydroorotase 0.9899 1 417 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.94 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map