F313186

General Info

Members Datasets Scaffolds Average Seq Length
204 168 408 258

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355406|2793984387
Length 289
Sequence GMIPADPPRWGGGGPGADEKGHTVRRFEGYAVMLTGAGRGIGEVTARRFADEGAQVLITDQDGERAAKAAESIRADGGEAESLGCDVALRADVEATVAHAVRSFGRLDVLVNSAHSCHVDTPLFEDQADDEWQQDIDVTLGGAFRCSRAALPHLAAAEGRGAIVNVGSVNGLQDFGNHAYSAAKAGLGSLTRTLAAHAAARGVRVNLVAPGTIRTPGWDGQEDTLRRAAEVYPLGRVGEPTDIAAAITFLASSDAAWITGITLPVDGGITTTNVAVRRAFGHLETPSET

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
46 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
88 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
128 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
129 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
130 2643221548 Streptomyces sp. Root55 Isolate Unclassified
131 2643221578 Streptomyces sp. Root63 Isolate Unclassified
132 2643221647 Streptomyces sp. Root369 Isolate Unclassified
133 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
134 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
135 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
136 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
137 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
138 2808606448 Streptomyces sp. 193411 Isolate Unclassified
139 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
140 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
141 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
142 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
143 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
144 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
145 2862574272 Streptomyces sp. AcE210 Isolate Nodule
146 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
147 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
148 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
149 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
150 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
151 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
152 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
153 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
154 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
155 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
156 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
157 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
158 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
159 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
160 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
161 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
162 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
163 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
164 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
165 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
166 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
167 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
168 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.43
Metatranscriptomes 0.98
Isolates 20.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.78
Nodule 2.45
Rhizoplane 1.96
Rhizosphere 66.18
Stem 0
Stem Tuber 0
Unclassified 5.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10035580 3300002067 Bacteria 1464
2 rootH1_10017295 3300003316 Bacteria 1825
3 rootL2_10050735 3300003322 Bacteria 1644
4 rootH1_10039884 3300003323 Bacteria 2146
5 Ga0006562J51391_1156797 3300003578 Bacteria 1390
6 Ga0006562J51391_1218550 3300003578 Bacteria 3580
7 Ga0070661_100280764 3300005344 Unclassified 1292
8 Ga0070668_100358211 3300005347 Unclassified 1236
9 Ga0070659_100444449 3300005366 Unclassified 1099
10 Ga0070663_100004663 3300005455 Bacteria 8081
11 Ga0070678_100300892 3300005456 Unclassified 1363
12 Ga0068856_100160832 3300005614 Bacteria 2256
13 Ga0068858_100233956 3300005842 Bacteria 1742
14 Ga0075368_10008013 3300006042 Bacteria 3747
15 Ga0075363_100007167 3300006048 Bacteria 5105
16 Ga0075363_100009829 3300006048 Bacteria 4511
17 Ga0075367_10002494 3300006178 Bacteria 8433
18 Ga0075367_10011757 3300006178 Bacteria 4645
19 Ga0075370_10007669 3300006353 Bacteria 5510
20 Ga0075370_10150910 3300006353 Bacteria 1362
21 Ga0099826_10031650 3300006948 Bacteria 3823
22 Ga0114129_10444259 3300009147 Bacteria 1702
23 Ga0105248_10242739 3300009177 Bacteria 2028
24 Ga0163162_10588741 3300013306 Unclassified 1239
25 Ga0163163_10312636 3300014325 Unclassified 1624
26 Ga0182008_10006613 3300014497 Bacteria 6462
27 Ga0157379_10361499 3300014968 Bacteria 1330
28 Ga0183367_1004 3300015688 Bacteria 716880
29 Ga0209758_1001121 3300025297 Bacteria 34485
30 Ga0207426_1005932 3300025302 Bacteria 5426
31 Ga0207647_10025984 3300025904 Bacteria 3837
32 Ga0207649_10230153 3300025920 Unclassified 1325
33 Ga0207644_10209153 3300025931 Bacteria 1542
34 Ga0207690_10362417 3300025932 Unclassified 1149
35 Ga0207711_10133254 3300025941 Bacteria 2230
36 Ga0207668_10302178 3300025972 Unclassified 1321
37 Ga0207678_10000586 3300026067 Bacteria 33284
38 Ga0207641_10367090 3300026088 Unclassified 1376
39 Ga0207675_100647730 3300026118 Unclassified 1062
40 Ga0209282_1146556 3300027666 Bacteria 1146
41 Ga0209813_10010847 3300027866 Bacteria 2368
42 Ga0268266_10001346 3300028379 Bacteria 29681
43 Ga0307515_10006168 3300028794 Bacteria 24095
44 Ga0307511_10000186 3300030521 Bacteria 61499
45 Ga0307512_10020364 3300030522 Bacteria 6007
46 Ga0307513_10085990 3300031456 Bacteria 3226
47 Ga0307509_10032556 3300031507 Bacteria 5744
48 Ga0307509_10190135 3300031507 Bacteria 1905
49 Ga0307508_10005246 3300031616 Bacteria 12371
50 Ga0307508_10225417 3300031616 Bacteria 1473
51 Ga0307514_10001314 3300031649 Bacteria 31830
52 Ga0307516_10003453 3300031730 Bacteria 20261
53 Ga0307516_10022190 3300031730 Bacteria 6524
54 Ga0307518_10013176 3300031838 Bacteria 5907
55 Ga0307409_100073895 3300031995 Bacteria 2722
56 Ga0307507_10026408 3300033179 Bacteria 6261
57 Ga0307507_10236514 3300033179 Bacteria 1202
58 Ga0307510_10046291 3300033180 Bacteria 4680
59 Ga0307510_10076602 3300033180 Bacteria 3288
60 Ga0307510_10084096 3300033180 Bacteria 3067
61 Ga0395898_0001353 3300037466 Bacteria 35343
62 Ga0395898_0021863 3300037466 Bacteria 6480
63 Ga0395905_0053219 3300037471 Bacteria 3789
64 Ga0439436_0003362 3300041404 Bacteria 4852
65 Ga0451853_2637939 3300041512 Bacteria 1647
66 Ga0439448_0002157 3300042005 Bacteria 5304
67 Ga0439457_002046 3300042014 Bacteria 5913
68 Ga0450903_008497 3300042138 Bacteria 1679
69 Ga0466966_0133525 3300044684 Bacteria 1519
70 Ga0466963_0001564 3300044694 Bacteria 12409
71 Ga0466967_0003993 3300045976 Bacteria 9831
72 Ga0466967_0384953 3300045976 Bacteria 1362
73 Ga0495592_0025786 3300046454 Bacteria 4462
74 Ga0495603_0004517 3300046455 Bacteria 8303
75 Ga0495603_0017450 3300046455 Bacteria 4342
76 Ga0495603_0027260 3300046455 Bacteria 3449
77 Ga0495603_0062243 3300046455 Bacteria 2203
78 Ga0495629_0005117 3300046459 Bacteria 9803
79 Ga0495629_0013651 3300046459 Bacteria 5861
80 Ga0495638_0070686 3300046460 Bacteria 2137
81 Ga0495605_0042792 3300046474 Bacteria 2248
82 Ga0495639_0003396 3300046475 Bacteria 6900
83 Ga0495585_0058993 3300046492 Bacteria 2116
84 Ga0495594_0000491 3300046499 Bacteria 20171
85 Ga0495594_0092023 3300046499 Bacteria 1700
86 Ga0495607_0031087 3300046501 Bacteria 3271
87 Ga0495606_0011199 3300046507 Bacteria 7340
88 Ga0495608_0195570 3300046511 Bacteria 1276
89 Ga0495620_0069393 3300046515 Bacteria 1446
90 Ga0495620_0108853 3300046515 Bacteria 1099
91 Ga0495628_0215988 3300046516 Bacteria 1441
92 Ga0495631_0037354 3300046518 Bacteria 2164
93 Ga0495633_0010816 3300046558 Bacteria 4963
94 Ga0495668_0100611 3300046616 Bacteria 1581
95 Ga0495634_0091226 3300046642 Bacteria 1978
96 Ga0495625_0007592 3300046660 Bacteria 9415
97 Ga0495625_0022925 3300046660 Bacteria 4777
98 Ga0495588_0031390 3300046674 Bacteria 2673
99 Ga0495657_0038761 3300046675 Bacteria 3277
100 Ga0495623_0221102 3300046679 Bacteria 1079
101 Ga0495670_0181728 3300046691 Bacteria 1111
102 Ga0495589_0009200 3300046794 Bacteria 5136
103 Ga0495589_0201141 3300046794 Bacteria 940
104 Ga0495676_0051734 3300047321 Bacteria 3283
105 Ga0495676_0051757 3300047321 Bacteria 3282
106 Ga0495676_0098454 3300047321 Bacteria 2169
107 Ga0495680_0212401 3300047322 Bacteria 1385
108 Ga0495687_001673 3300047443 Bacteria 19799
109 Ga0495685_001986 3300047447 Bacteria 6343
110 Ga0495685_012341 3300047447 Bacteria 2894
111 Ga0495685_058286 3300047447 Bacteria 1303
112 Ga0495681_0005746 3300047470 Bacteria 8251
113 Ga0495593_0023680 3300047673 Bacteria 3410
114 Ga0495614_0013660 3300048089 Bacteria 3561
115 Ga0495614_0029056 3300048089 Bacteria 2380
116 Ga0495626_0018770 3300048091 Bacteria 3465
117 Ga0496102_0019602 3300048905 Bacteria 5959
118 Ga0496102_0580985 3300048905 Bacteria 1043
119 Ga0496104_0240432 3300048907 Bacteria 1723
120 Ga0495678_020872 3300049459 Bacteria 2892
121 Ga0501031_0005073 3300049568 Bacteria 8569
122 Ga0501032_0008731 3300049569 Bacteria 7380
123 Ga0501032_0102331 3300049569 Bacteria 1898
124 Ga0501033_0005858 3300049570 Bacteria 9661
125 Ga0501033_0014510 3300049570 Bacteria 5981
126 Ga0501036_0084552 3300049572 Bacteria 2682
127 Ga0501036_0344695 3300049572 Bacteria 1244
128 Ga0501037_0004708 3300049573 Bacteria 9916
129 Ga0501038_0041107 3300049574 Bacteria 4033
130 Ga0501039_0119759 3300049575 Bacteria 2062
131 Ga0501042_0026714 3300049578 Bacteria 4056
132 Ga0501043_0005097 3300049579 Bacteria 10632
133 Ga0501043_0093633 3300049579 Bacteria 2362
134 Ga0501046_0009832 3300049580 Bacteria 8247
135 Ga0501047_0053756 3300049581 Bacteria 3895
136 Ga0501048_0179816 3300049582 Bacteria 1499
137 Ga0501070_0203885 3300049586 Bacteria 1624
138 Ga0501072_0156242 3300049588 Bacteria 1819
139 Ga0501080_0020328 3300049742 Bacteria 6144
140 Ga0501035_0008276 3300049822 Bacteria 9692
141 Ga0501035_0105451 3300049822 Bacteria 2471
142 Ga0501035_0122860 3300049822 Bacteria 2268
143 Ga0501035_0223421 3300049822 Bacteria 1607
144 Ga0501044_0025237 3300049823 Bacteria 6301
145 Ga0501044_0060718 3300049823 Bacteria 3869
146 Ga0501044_0579851 3300049823 Bacteria 1016
147 nmdc:mga03683_44887_c1 3300050489 Bacteria 1827
148 nmdc:mga03n38_8260_c1 3300050490 Bacteria 3727
149 nmdc:mga00v17_65465_c1 3300050491 Bacteria 2242
150 nmdc:mga0yw44_85732_c1 3300050492 Bacteria 1982
151 nmdc:mga06z11_1396_c1 3300050494 Bacteria 8965
152 nmdc:mga06z11_821_c1 3300050494 Bacteria 11363
153 nmdc:mga04h51_3652_c1 3300050495 Bacteria 3761
154 nmdc:mga07m45_6546_c1 3300050496 Bacteria 5896
155 nmdc:mga05p37_293591_c1 3300050507 Bacteria 1934
156 Ga0495601_0045714 3300053077 Bacteria 2754
157 Ga0495612_0015536 3300053078 Bacteria 3052
158 Ga0500610_0075008 3300053079 Bacteria 1764
159 Ga0500644_0029551 3300053088 Bacteria 1725
160 Ga0500560_010128 3300053107 Bacteria 2348
161 Ga0500573_0138225 3300053140 Bacteria 1344
162 Ga0466962_0023840 3300061719 Bacteria 2941
163 2793984387 2791355406 Bacteria 11364898
164 2547409370 2547132111 Bacteria 8013147
165 2616903988 2616644941 Bacteria 8510691
166 2643765686 2643221548 Bacteria 8053412
167 2643898521 2643221578 Bacteria 9213798
168 2644266828 2643221647 Bacteria 10741251
169 2644406437 2643221673 Bacteria 9196637
170 2644459798 2643221682 Bacteria 6743283
171 2784592337 2784132148 Bacteria 8627943
172 2785339218 2784746763 Bacteria 9783172
173 2804847272 2802429296 Bacteria 7227771
174 2809235967 2808606448 Bacteria 8656184
175 2812483100 2811994917 Bacteria 7761064
176 2819697930 2818991463 Bacteria 7948711
177 2862179565 2862178590 Bacteria 8583590
178 2862283808 2862281513 Bacteria 9621493
179 2862384939 2862382967 Bacteria 10317375
180 2862515868 2862507626 Bacteria 9425308
181 2862579398 2862574272 Bacteria 10567477
182 2863410719 2863404153 Bacteria 9672205
183 2875394398 2875391855 Bacteria 7600475
184 2877677219 2877676314 Bacteria 9512378
185 2912728349 2912723979 Bacteria 8557534
186 2912760545 2912757875 Bacteria 7940295
187 2946050211 2946045630 Bacteria 8527308
188 2954381945 2954380949 Bacteria 10050426
189 2954692753 2954691527 Bacteria 10720516
190 2954707826 2954701450 Bacteria 10834262
191 2966602719 2966598605 Bacteria 7676064
192 3006395476 3006393351 Bacteria 6615579
193 8008564763 8008558824 Bacteria 10610750
194 8008575479 8008574985 Bacteria 7815457
195 8025415920 8025413630 Bacteria 7014048
196 8025536586 8025530807 Bacteria 8495698
197 8047896672 8047893842 Bacteria 11723082
198 8048134634 8048127548 Bacteria 11053136
199 8048362263 8048356638 Bacteria 11044339
200 8048373685 8048369669 Bacteria 11666822
201 8048384557 8048379754 Bacteria 11877923
202 8054164099 8054160619 Bacteria 7783213
203 8056450161 8056447290 Bacteria 7680491
204 8056834823 8056829672 Bacteria 9045328
205 JGI24735J21928_10035580
206 rootH1_10017295
207 rootL2_10050735
208 rootH1_10039884
209 Ga0006562J51391_1156797
210 Ga0006562J51391_1218550
211 Ga0070661_100280764
212 Ga0070668_100358211
213 Ga0070659_100444449
214 Ga0070663_100004663
215 Ga0070678_100300892
216 Ga0068856_100160832
217 Ga0068858_100233956
218 Ga0075368_10008013
219 Ga0075363_100007167
220 Ga0075363_100009829
221 Ga0075367_10002494
222 Ga0075367_10011757
223 Ga0075370_10007669
224 Ga0075370_10150910
225 Ga0099826_10031650
226 Ga0114129_10444259
227 Ga0105248_10242739
228 Ga0163162_10588741
229 Ga0163163_10312636
230 Ga0182008_10006613
231 Ga0157379_10361499
232 Ga0183367_1004
233 Ga0209758_1001121
234 Ga0207426_1005932
235 Ga0207647_10025984
236 Ga0207649_10230153
237 Ga0207644_10209153
238 Ga0207690_10362417
239 Ga0207711_10133254
240 Ga0207668_10302178
241 Ga0207678_10000586
242 Ga0207641_10367090
243 Ga0207675_100647730
244 Ga0209282_1146556
245 Ga0209813_10010847
246 Ga0268266_10001346
247 Ga0307515_10006168
248 Ga0307511_10000186
249 Ga0307512_10020364
250 Ga0307513_10085990
251 Ga0307509_10032556
252 Ga0307509_10190135
253 Ga0307508_10005246
254 Ga0307508_10225417
255 Ga0307514_10001314
256 Ga0307516_10003453
257 Ga0307516_10022190
258 Ga0307518_10013176
259 Ga0307409_100073895
260 Ga0307507_10026408
261 Ga0307507_10236514
262 Ga0307510_10046291
263 Ga0307510_10076602
264 Ga0307510_10084096
265 Ga0395898_0001353
266 Ga0395898_0021863
267 Ga0395905_0053219
268 Ga0439436_0003362
269 Ga0451853_2637939
270 Ga0439448_0002157
271 Ga0439457_002046
272 Ga0450903_008497
273 Ga0466966_0133525
274 Ga0466963_0001564
275 Ga0466967_0003993
276 Ga0466967_0384953
277 Ga0495592_0025786
278 Ga0495603_0004517
279 Ga0495603_0017450
280 Ga0495603_0027260
281 Ga0495603_0062243
282 Ga0495629_0005117
283 Ga0495629_0013651
284 Ga0495638_0070686
285 Ga0495605_0042792
286 Ga0495639_0003396
287 Ga0495585_0058993
288 Ga0495594_0000491
289 Ga0495594_0092023
290 Ga0495607_0031087
291 Ga0495606_0011199
292 Ga0495608_0195570
293 Ga0495620_0069393
294 Ga0495620_0108853
295 Ga0495628_0215988
296 Ga0495631_0037354
297 Ga0495633_0010816
298 Ga0495668_0100611
299 Ga0495634_0091226
300 Ga0495625_0007592
301 Ga0495625_0022925
302 Ga0495588_0031390
303 Ga0495657_0038761
304 Ga0495623_0221102
305 Ga0495670_0181728
306 Ga0495589_0009200
307 Ga0495589_0201141
308 Ga0495676_0051734
309 Ga0495676_0051757
310 Ga0495676_0098454
311 Ga0495680_0212401
312 Ga0495687_001673
313 Ga0495685_001986
314 Ga0495685_012341
315 Ga0495685_058286
316 Ga0495681_0005746
317 Ga0495593_0023680
318 Ga0495614_0013660
319 Ga0495614_0029056
320 Ga0495626_0018770
321 Ga0496102_0019602
322 Ga0496102_0580985
323 Ga0496104_0240432
324 Ga0495678_020872
325 Ga0501031_0005073
326 Ga0501032_0008731
327 Ga0501032_0102331
328 Ga0501033_0005858
329 Ga0501033_0014510
330 Ga0501036_0084552
331 Ga0501036_0344695
332 Ga0501037_0004708
333 Ga0501038_0041107
334 Ga0501039_0119759
335 Ga0501042_0026714
336 Ga0501043_0005097
337 Ga0501043_0093633
338 Ga0501046_0009832
339 Ga0501047_0053756
340 Ga0501048_0179816
341 Ga0501070_0203885
342 Ga0501072_0156242
343 Ga0501080_0020328
344 Ga0501035_0008276
345 Ga0501035_0105451
346 Ga0501035_0122860
347 Ga0501035_0223421
348 Ga0501044_0025237
349 Ga0501044_0060718
350 Ga0501044_0579851
351 nmdc:mga03683_44887_c1
352 nmdc:mga03n38_8260_c1
353 nmdc:mga00v17_65465_c1
354 nmdc:mga0yw44_85732_c1
355 nmdc:mga06z11_1396_c1
356 nmdc:mga06z11_821_c1
357 nmdc:mga04h51_3652_c1
358 nmdc:mga07m45_6546_c1
359 nmdc:mga05p37_293591_c1
360 Ga0495601_0045714
361 Ga0495612_0015536
362 Ga0500610_0075008
363 Ga0500644_0029551
364 Ga0500560_010128
365 Ga0500573_0138225
366 Ga0466962_0023840
367 2793984387
368 2547409370
369 2616903988
370 2643765686
371 2643898521
372 2644266828
373 2644406437
374 2644459798
375 2784592337
376 2785339218
377 2804847272
378 2809235967
379 2812483100
380 2819697930
381 2862179565
382 2862283808
383 2862384939
384 2862515868
385 2862579398
386 2863410719
387 2875394398
388 2877677219
389 2912728349
390 2912760545
391 2946050211
392 2954381945
393 2954692753
394 2954707826
395 2966602719
396 3006395476
397 8008564763
398 8008575479
399 8025415920
400 8025536586
401 8047896672
402 8048134634
403 8048362263
404 8048373685
405 8048384557
406 8054164099
407 8056450161
408 8056834823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

225

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

270

0.92

PF08659

KR

KR domain

31

215

0.81

PF23441

32

271

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9504 7 253
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.9476 7 239
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.947 4 239
5jy1-assembly1.cif.gz_D crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 bound to nad 0.9466 5 236
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.946 5 236
ID Description Score Start End Superfamily
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 7 235 3.40.50.720
af_I6YCE1_8_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9478 1 235 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.947 4 239 3.40.50.720
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9466 5 236 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9461 7 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7K2MS97-F1-model_v4 SDR family oxidoreductase 0.9934 67 252
AF-A0A5N8VDS4-F1-model_v4 SDR family oxidoreductase 0.9883 2 247 GO:0016616
AF-A0A1Q5GB01-F1-model_v4 Oxidoreductase 0.9877 14 247 GO:0016616
GO:0030497
AF-A0A1G9GZE3-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9867 5 249
AF-A0A014LIB4-F1-model_v4 Oxidoreductase 0.9845 5 249 GO:0016616

Map