F312803

General Info

Members Datasets Scaffolds Average Seq Length
204 130 408 103

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0442032|Ga0436363_0442032_504_863
Length 119
Sequence LSPRRRSPRSVGHALDAARQRWEPATLLAEIQALWPAVVGEAIAEQASPTAERGGAVTISCAASVWAQELDLMAPSILERLNARLNGHEVLRLRCITAPLADRPPTPEKFGRGRVDTAG

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.8
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0442032 3300039450 Bacteria 3129
2 Ga0068868_100457725 3300005338 Bacteria 1111
3 Ga0070660_101538190 3300005339 Bacteria 566
4 Ga0070661_100840432 3300005344 Bacteria 755
5 Ga0070714_101500184 3300005435 Unclassified 658
6 Ga0070713_100029248 3300005436 Bacteria 4361
7 Ga0070713_100242288 3300005436 Bacteria 1642
8 Ga0070710_10006522 3300005437 Bacteria 5610
9 Ga0070710_10600505 3300005437 Unclassified 766
10 Ga0070711_100056831 3300005439 Bacteria 2707
11 Ga0070663_101036010 3300005455 Bacteria 715
12 Ga0070681_10610741 3300005458 Bacteria 1005
13 Ga0070686_100360540 3300005544 Bacteria 1095
14 Ga0070665_100123657 3300005548 Bacteria 2589
15 Ga0068855_102435524 3300005563 Bacteria 522
16 Ga0068856_100070485 3300005614 Bacteria 3458
17 Ga0068856_102377635 3300005614 Bacteria 537
18 Ga0070702_101343201 3300005615 Bacteria 582
19 Ga0068852_102455002 3300005616 Unclassified 542
20 Ga0068864_100217444 3300005618 Bacteria 1762
21 Ga0068864_100856266 3300005618 Bacteria 896
22 Ga0068864_101273330 3300005618 Unclassified 735
23 Ga0068864_102061326 3300005618 Unclassified 577
24 Ga0068866_10829811 3300005718 Bacteria 645
25 Ga0068858_100184977 3300005842 Bacteria 1968
26 Ga0068862_100551149 3300005844 Bacteria 1101
27 Ga0070717_10079924 3300006028 Bacteria 2742
28 Ga0070717_10184765 3300006028 Bacteria 1819
29 Ga0070717_11010109 3300006028 Bacteria 757
30 Ga0070717_11126179 3300006028 Bacteria 715
31 Ga0070715_10273143 3300006163 Unclassified 893
32 Ga0070716_100441007 3300006173 Unclassified 947
33 Ga0070712_100002855 3300006175 Bacteria 10693
34 Ga0075436_100996049 3300006914 Bacteria 629
35 Ga0075435_100710067 3300007076 Bacteria 874
36 Ga0111539_13215803 3300009094 Unclassified 526
37 Ga0105245_10181227 3300009098 Bacteria 2013
38 Ga0105242_10621602 3300009176 Bacteria 1046
39 Ga0105239_11964145 3300010375 Bacteria 679
40 Ga0163162_10298089 3300013306 Bacteria 1744
41 Ga0157375_11242223 3300013308 Bacteria 875
42 Ga0157380_10997874 3300014326 Bacteria 870
43 Ga0157376_10003032 3300014969 Bacteria 11509
44 Ga0213874_10373895 3300021377 Bacteria 550
45 Ga0213876_10001166 3300021384 Bacteria 16591
46 Ga0213876_10024766 3300021384 Bacteria 3168
47 Ga0213876_10108835 3300021384 Bacteria 1471
48 Ga0213875_10604740 3300021388 Bacteria 530
49 Ga0207692_10156664 3300025898 Bacteria 1309
50 Ga0207692_10702859 3300025898 Bacteria 656
51 Ga0207685_10488675 3300025905 Unclassified 646
52 Ga0207693_10001975 3300025915 Bacteria 17977
53 Ga0207663_10274641 3300025916 Bacteria 1250
54 Ga0207663_10723542 3300025916 Bacteria 789
55 Ga0207657_10258865 3300025919 Bacteria 1385
56 Ga0207649_11293521 3300025920 Bacteria 577
57 Ga0207700_10018866 3300025928 Bacteria 4646
58 Ga0207700_10233991 3300025928 Bacteria 1563
59 Ga0207700_10235117 3300025928 Bacteria 1560
60 Ga0207664_10427923 3300025929 Bacteria 1180
61 Ga0207669_10665324 3300025937 Bacteria 853
62 Ga0207665_10007857 3300025939 Bacteria 7045
63 Ga0207661_11214067 3300025944 Bacteria 694
64 Ga0207668_10192111 3300025972 Bacteria 1619
65 Ga0207677_11704739 3300026023 Bacteria 584
66 Ga0207703_10387016 3300026035 Bacteria 1295
67 Ga0207639_11672409 3300026041 Bacteria 597
68 Ga0207639_12191569 3300026041 Bacteria 514
69 Ga0207678_10146411 3300026067 Bacteria 2016
70 Ga0207678_10553451 3300026067 Bacteria 1006
71 Ga0207702_10891027 3300026078 Bacteria 881
72 Ga0207676_10141186 3300026095 Bacteria 2062
73 Ga0207675_101557994 3300026118 Bacteria 681
74 Ga0207698_11414166 3300026142 Bacteria 711
75 Ga0268266_10015549 3300028379 Bacteria 6525
76 Ga0307407_11654481 3300031903 Unclassified 509
77 Ga0307416_101733793 3300032002 Bacteria 729
78 Ga0373953_0221765 3300035117 Unclassified 819
79 Ga0373956_0190132 3300035119 Bacteria 972
80 Ga0373957_0561250 3300035120 Unclassified 500
81 Ga0373933_0303541 3300035724 Bacteria 1034
82 Ga0373937_0030999 3300036401 Bacteria 4842
83 Ga0395899_0560420 3300037312 Bacteria 733
84 Ga0395900_0898549 3300037418 Bacteria 809
85 Ga0395898_0212264 3300037466 Bacteria 1846
86 Ga0395898_0331581 3300037466 Bacteria 1451
87 Ga0395898_0687806 3300037466 Bacteria 965
88 Ga0395905_0215755 3300037471 Bacteria 1797
89 Ga0436364_0213963 3300037853 Bacteria 3033
90 Ga0436364_0292139 3300037853 Bacteria 990
91 Ga0436364_0516104 3300037853 Bacteria 530
92 Ga0436364_0649163 3300037853 Bacteria 978
93 Ga0436364_0655936 3300037853 Bacteria 4598
94 Ga0436364_0746030 3300037853 Bacteria 86955
95 Ga0436364_0946450 3300037853 Unclassified 565
96 Ga0436364_1031518 3300037853 Bacteria 4510
97 Ga0436364_1046178 3300037853 Bacteria 5587
98 Ga0395901_0065494 3300038443 Bacteria 3783
99 Ga0395901_0210338 3300038443 Bacteria 2036
100 Ga0395901_1005963 3300038443 Bacteria 809
101 Ga0436365_0335344 3300039437 Bacteria 1543
102 Ga0436365_0562857 3300039437 Bacteria 16304
103 Ga0436365_0720410 3300039437 Unclassified 769
104 Ga0436365_1240313 3300039437 Bacteria 946
105 Ga0436365_1428637 3300039437 Bacteria 4011
106 Ga0436363_0126822 3300039450 Unclassified 549
107 Ga0436363_0730541 3300039450 Bacteria 1647
108 Ga0436363_0902331 3300039450 Bacteria 705
109 Ga0436363_1265155 3300039450 Bacteria 80087
110 Ga0436363_1366271 3300039450 Unclassified 688
111 Ga0436362_0878718 3300039453 Bacteria 653
112 Ga0436362_1105256 3300039453 Unclassified 1812
113 Ga0436362_1245767 3300039453 Bacteria 767
114 Ga0451853_3450048 3300041512 Bacteria 725
115 Ga0466969_0036612 3300044656 Bacteria 2478
116 Ga0466966_0229602 3300044684 Bacteria 1120
117 Ga0466961_0008044 3300044693 Bacteria 6720
118 Ga0466961_0155294 3300044693 Bacteria 1428
119 Ga0466963_0041341 3300044694 Bacteria 3024
120 Ga0466971_0024437 3300044719 Bacteria 2696
121 Ga0466971_0053788 3300044719 Unclassified 1814
122 Ga0466971_0133502 3300044719 Bacteria 1154
123 Ga0466971_0520865 3300044719 Bacteria 588
124 Ga0466968_0179990 3300044735 Bacteria 983
125 Ga0466968_0246536 3300044735 Bacteria 847
126 Ga0466968_0336184 3300044735 Unclassified 732
127 Ga0466970_0101325 3300044765 Bacteria 1568
128 Ga0466957_0022883 3300044842 Bacteria 3690
129 Ga0466957_0334799 3300044842 Bacteria 1024
130 Ga0466957_0922405 3300044842 Unclassified 625
131 Ga0466959_0041272 3300045049 Bacteria 3406
132 Ga0466959_0123942 3300045049 Bacteria 1835
133 Ga0466959_0549946 3300045049 Bacteria 778
134 Ga0466958_0005690 3300045836 Bacteria 6732
135 Ga0466958_0036800 3300045836 Bacteria 2931
136 Ga0466958_0164416 3300045836 Bacteria 1403
137 Ga0466958_0263311 3300045836 Bacteria 1104
138 Ga0466958_0295011 3300045836 Unclassified 1040
139 Ga0466967_0038295 3300045976 Bacteria 4111
140 Ga0495651_0090287 3300046462 Bacteria 2298
141 Ga0495653_0059282 3300046463 Bacteria 2906
142 Ga0495608_0007234 3300046511 Bacteria 7851
143 Ga0495618_0228167 3300046514 Bacteria 1173
144 Ga0495628_0230118 3300046516 Bacteria 1390
145 Ga0495630_0044663 3300046517 Bacteria 3311
146 Ga0495630_0432276 3300046517 Bacteria 1009
147 Ga0495652_0035679 3300046529 Bacteria 4327
148 Ga0495652_0793119 3300046529 Bacteria 631
149 Ga0495640_0681565 3300046533 Unclassified 617
150 Ga0495587_0042854 3300046536 Bacteria 2697
151 Ga0495645_0226103 3300046543 Bacteria 1256
152 Ga0495645_0381909 3300046543 Bacteria 901
153 Ga0495667_0010329 3300046559 Bacteria 6315
154 Ga0495634_0114092 3300046642 Bacteria 1735
155 Ga0495635_0051058 3300046663 Bacteria 2850
156 Ga0495635_0442385 3300046663 Bacteria 860
157 Ga0495657_0007417 3300046675 Bacteria 8474
158 Ga0495658_1064642 3300046683 Unclassified 516
159 Ga0495613_0101397 3300046689 Bacteria 2079
160 Ga0495613_0246494 3300046689 Bacteria 1248
161 Ga0495600_0457059 3300046809 Bacteria 789
162 Ga0495604_0037630 3300047317 Bacteria 3809
163 Ga0495674_0063272 3300047319 Bacteria 3219
164 Ga0495674_0102145 3300047319 Bacteria 2438
165 Ga0495680_0044779 3300047322 Bacteria 3497
166 Ga0495675_0446052 3300047444 Bacteria 749
167 Ga0495675_0478553 3300047444 Bacteria 717
168 Ga0495684_0311402 3300047471 Bacteria 1128
169 Ga0495593_0144831 3300047673 Bacteria 1203
170 Ga0495593_0444933 3300047673 Bacteria 648
171 Ga0495602_0010166 3300048088 Bacteria 9768
172 Ga0495602_1017204 3300048088 Bacteria 546
173 Ga0496100_0000820 3300048903 Bacteria 14920
174 Ga0496101_0002036 3300048904 Bacteria 12296
175 Ga0496102_0444161 3300048905 Bacteria 1217
176 Ga0496104_0044092 3300048907 Bacteria 4191
177 Ga0496105_0881952 3300048908 Bacteria 675
178 Ga0496107_0105030 3300048910 Bacteria 2073
179 Ga0496108_0053688 3300048911 Bacteria 3380
180 Ga0496108_0611603 3300048911 Bacteria 949
181 Ga0496108_1373999 3300048911 Unclassified 592
182 Ga0496109_0024048 3300048912 Bacteria 5412
183 Ga0496109_0075001 3300048912 Bacteria 3110
184 Ga0496110_0225011 3300048913 Bacteria 1706
185 Ga0496110_0259398 3300048913 Bacteria 1582
186 Ga0496111_0103869 3300048914 Bacteria 2090
187 Ga0496112_0002882 3300048915 Bacteria 13995
188 Ga0496112_0075062 3300048915 Bacteria 3344
189 Ga0496112_0172841 3300048915 Bacteria 2126
190 Ga0496113_0104954 3300048916 Bacteria 2193
191 Ga0496114_0131666 3300048917 Bacteria 2160
192 Ga0496115_0268631 3300048918 Bacteria 1402
193 Ga0501067_0117383 3300049583 Bacteria 1480
194 Ga0501067_0553991 3300049583 Bacteria 644
195 nmdc:mga0n895_1222787_c1 3300050512 Bacteria 724
196 nmdc:mga0rr50_678608_c1 3300050513 Bacteria 879
197 Ga0495601_0291936 3300053077 Bacteria 1063
198 Ga0495595_0009352 3300053084 Bacteria 4052
199 Ga0495595_0729409 3300053084 Unclassified 508
200 Ga0495619_0019707 3300053085 Bacteria 4291
201 Ga0495619_0497022 3300053085 Bacteria 839
202 Ga0466962_0023073 3300061719 Bacteria 2991
203 Ga0466962_0090702 3300061719 Bacteria 1464
204 Ga0466962_0306669 3300061719 Bacteria 786
205 Ga0436363_0442032
206 Ga0068868_100457725
207 Ga0070660_101538190
208 Ga0070661_100840432
209 Ga0070714_101500184
210 Ga0070713_100029248
211 Ga0070713_100242288
212 Ga0070710_10006522
213 Ga0070710_10600505
214 Ga0070711_100056831
215 Ga0070663_101036010
216 Ga0070681_10610741
217 Ga0070686_100360540
218 Ga0070665_100123657
219 Ga0068855_102435524
220 Ga0068856_100070485
221 Ga0068856_102377635
222 Ga0070702_101343201
223 Ga0068852_102455002
224 Ga0068864_100217444
225 Ga0068864_100856266
226 Ga0068864_101273330
227 Ga0068864_102061326
228 Ga0068866_10829811
229 Ga0068858_100184977
230 Ga0068862_100551149
231 Ga0070717_10079924
232 Ga0070717_10184765
233 Ga0070717_11010109
234 Ga0070717_11126179
235 Ga0070715_10273143
236 Ga0070716_100441007
237 Ga0070712_100002855
238 Ga0075436_100996049
239 Ga0075435_100710067
240 Ga0111539_13215803
241 Ga0105245_10181227
242 Ga0105242_10621602
243 Ga0105239_11964145
244 Ga0163162_10298089
245 Ga0157375_11242223
246 Ga0157380_10997874
247 Ga0157376_10003032
248 Ga0213874_10373895
249 Ga0213876_10001166
250 Ga0213876_10024766
251 Ga0213876_10108835
252 Ga0213875_10604740
253 Ga0207692_10156664
254 Ga0207692_10702859
255 Ga0207685_10488675
256 Ga0207693_10001975
257 Ga0207663_10274641
258 Ga0207663_10723542
259 Ga0207657_10258865
260 Ga0207649_11293521
261 Ga0207700_10018866
262 Ga0207700_10233991
263 Ga0207700_10235117
264 Ga0207664_10427923
265 Ga0207669_10665324
266 Ga0207665_10007857
267 Ga0207661_11214067
268 Ga0207668_10192111
269 Ga0207677_11704739
270 Ga0207703_10387016
271 Ga0207639_11672409
272 Ga0207639_12191569
273 Ga0207678_10146411
274 Ga0207678_10553451
275 Ga0207702_10891027
276 Ga0207676_10141186
277 Ga0207675_101557994
278 Ga0207698_11414166
279 Ga0268266_10015549
280 Ga0307407_11654481
281 Ga0307416_101733793
282 Ga0373953_0221765
283 Ga0373956_0190132
284 Ga0373957_0561250
285 Ga0373933_0303541
286 Ga0373937_0030999
287 Ga0395899_0560420
288 Ga0395900_0898549
289 Ga0395898_0212264
290 Ga0395898_0331581
291 Ga0395898_0687806
292 Ga0395905_0215755
293 Ga0436364_0213963
294 Ga0436364_0292139
295 Ga0436364_0516104
296 Ga0436364_0649163
297 Ga0436364_0655936
298 Ga0436364_0746030
299 Ga0436364_0946450
300 Ga0436364_1031518
301 Ga0436364_1046178
302 Ga0395901_0065494
303 Ga0395901_0210338
304 Ga0395901_1005963
305 Ga0436365_0335344
306 Ga0436365_0562857
307 Ga0436365_0720410
308 Ga0436365_1240313
309 Ga0436365_1428637
310 Ga0436363_0126822
311 Ga0436363_0730541
312 Ga0436363_0902331
313 Ga0436363_1265155
314 Ga0436363_1366271
315 Ga0436362_0878718
316 Ga0436362_1105256
317 Ga0436362_1245767
318 Ga0451853_3450048
319 Ga0466969_0036612
320 Ga0466966_0229602
321 Ga0466961_0008044
322 Ga0466961_0155294
323 Ga0466963_0041341
324 Ga0466971_0024437
325 Ga0466971_0053788
326 Ga0466971_0133502
327 Ga0466971_0520865
328 Ga0466968_0179990
329 Ga0466968_0246536
330 Ga0466968_0336184
331 Ga0466970_0101325
332 Ga0466957_0022883
333 Ga0466957_0334799
334 Ga0466957_0922405
335 Ga0466959_0041272
336 Ga0466959_0123942
337 Ga0466959_0549946
338 Ga0466958_0005690
339 Ga0466958_0036800
340 Ga0466958_0164416
341 Ga0466958_0263311
342 Ga0466958_0295011
343 Ga0466967_0038295
344 Ga0495651_0090287
345 Ga0495653_0059282
346 Ga0495608_0007234
347 Ga0495618_0228167
348 Ga0495628_0230118
349 Ga0495630_0044663
350 Ga0495630_0432276
351 Ga0495652_0035679
352 Ga0495652_0793119
353 Ga0495640_0681565
354 Ga0495587_0042854
355 Ga0495645_0226103
356 Ga0495645_0381909
357 Ga0495667_0010329
358 Ga0495634_0114092
359 Ga0495635_0051058
360 Ga0495635_0442385
361 Ga0495657_0007417
362 Ga0495658_1064642
363 Ga0495613_0101397
364 Ga0495613_0246494
365 Ga0495600_0457059
366 Ga0495604_0037630
367 Ga0495674_0063272
368 Ga0495674_0102145
369 Ga0495680_0044779
370 Ga0495675_0446052
371 Ga0495675_0478553
372 Ga0495684_0311402
373 Ga0495593_0144831
374 Ga0495593_0444933
375 Ga0495602_0010166
376 Ga0495602_1017204
377 Ga0496100_0000820
378 Ga0496101_0002036
379 Ga0496102_0444161
380 Ga0496104_0044092
381 Ga0496105_0881952
382 Ga0496107_0105030
383 Ga0496108_0053688
384 Ga0496108_0611603
385 Ga0496108_1373999
386 Ga0496109_0024048
387 Ga0496109_0075001
388 Ga0496110_0225011
389 Ga0496110_0259398
390 Ga0496111_0103869
391 Ga0496112_0002882
392 Ga0496112_0075062
393 Ga0496112_0172841
394 Ga0496113_0104954
395 Ga0496114_0131666
396 Ga0496115_0268631
397 Ga0501067_0117383
398 Ga0501067_0553991
399 nmdc:mga0n895_1222787_c1
400 nmdc:mga0rr50_678608_c1
401 Ga0495601_0291936
402 Ga0495595_0009352
403 Ga0495595_0729409
404 Ga0495619_0019707
405 Ga0495619_0497022
406 Ga0466962_0023073
407 Ga0466962_0090702
408 Ga0466962_0306669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

10

95

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.9309 28 97
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8021 28 97
8a3v-assembly1.cif.gz_C crystal structure of the vibrio cholerae replicative helicase (vcdnab) in complex with its loader protein (vcdcia) 0.7727 12 99
2wp0-assembly1.cif.gz_C-2 crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori. 0.7028 45 98
3f0d-assembly2.cif.gz_E high resolution crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphatase synthase from burkholderia pseudomallei 0.688 55 96
ID Description Score Start End Superfamily
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7415 9 93 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7101 9 93 3.30.300.180
af_P9WNW3_9_100_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7044 41 96 3.30.300.180
2wp0C00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7028 45 98 3.30.300.180
af_Q18170_73_171_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6908 27 97 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A226BWQ0-F1-model_v4 DUF721 domain-containing protein 0.9623 30 98
AF-X1KK58-F1-model_v4 DUF721 domain-containing protein 0.952 27 98
AF-A0A847EB58-F1-model_v4 DUF721 domain-containing protein 0.9501 29 100
AF-A0A0S8IQ09-F1-model_v4 RNA-binding protein 0.948 30 98
AF-A0A7Y2FG08-F1-model_v4 DUF721 domain-containing protein 0.9451 29 100

Map