F312797

General Info

Members Datasets Scaffolds Average Seq Length
204 172 408 398

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0898433|Ga0436365_0898433_66_1412
Length 448
Sequence MDPIVRTGCDSARGTPDLIEFGDAPASPFSISSLRPGHDGAMSAGDLPLHDAATYTNGFPYEHFRELRRSEPISHHDHPTWERGYWAVVRHADVVRVSRDANFKNSPHPMIETMGDNDDAASLAELLISKDPPEHTRLRKLVSAGFTPRRVADLTDRIRERVDALVESVGERGSCDLVTDLALWLPLHVIADLVGVPEADRAHVFELTELTFGFDAAVTREQRHEAAMEMYAYADSLCEARRDAPRDDLLSVLLAAEVDGERLTQLQIDIFFMMLQNAGSETTRNLITTGMLALLQFPDQAERLRADLSLLPIAIEELLRYVTPVIQFVRRAERDTEIAGQAIAAGDRVLMVYSSANRDERAFSEPDAIDVTREPNPHVAFGAGGPHFCLGANLARLEARIMFEALLTRFDGLAVQGDPATLPRVHSNLIDGFAHLPVTWDAVVATPV

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
153 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
154 2738541337 Pelomonas sp. BT06 Isolate Unclassified
155 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
156 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
157 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
158 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
159 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
160 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
161 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
162 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
163 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
164 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
165 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
166 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
167 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
168 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
169 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
170 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
171 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
172 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 8.33
Nodule 0.49
Rhizoplane 5.39
Rhizosphere 76.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0898433 3300039437 Bacteria 1498
2 Ga0065714_10070496 3300005288 Bacteria 3830
3 Ga0070676_10110906 3300005328 Bacteria 1708
4 Ga0070683_100033059 3300005329 Bacteria 4713
5 Ga0070670_100018284 3300005331 Bacteria 6012
6 Ga0070682_100045770 3300005337 Bacteria 2714
7 Ga0068868_100116043 3300005338 Bacteria 2180
8 Ga0070669_100056939 3300005353 Bacteria 2867
9 Ga0070675_100026718 3300005354 Bacteria 4632
10 Ga0070671_100018650 3300005355 Bacteria 5638
11 Ga0070714_100355124 3300005435 Bacteria 1377
12 Ga0070708_100137362 3300005445 Bacteria 2265
13 Ga0070706_100084244 3300005467 Bacteria 2945
14 Ga0070707_100016663 3300005468 Bacteria 6898
15 Ga0068855_100099097 3300005563 Bacteria 3357
16 Ga0068854_100197739 3300005578 Bacteria 1578
17 Ga0068858_100015167 3300005842 Bacteria 7249
18 Ga0081455_10085932 3300005937 Bacteria 2563
19 Ga0081539_10022196 3300005985 Bacteria 4208
20 Ga0075365_10138738 3300006038 Bacteria 1687
21 Ga0075363_100000172 3300006048 Bacteria 16838
22 Ga0075363_100028185 3300006048 Bacteria 2886
23 Ga0075363_100054038 3300006048 Bacteria 2148
24 Ga0075363_100111234 3300006048 Bacteria 1523
25 Ga0075364_10099730 3300006051 Bacteria 1933
26 Ga0075364_10143933 3300006051 Bacteria 1604
27 Ga0075367_10114400 3300006178 Bacteria 1659
28 Ga0075435_100091392 3300007076 Bacteria 2512
29 Ga0099794_10012306 3300007265 Bacteria 3688
30 Ga0105244_10005997 3300009036 Bacteria 7959
31 Ga0105244_10026415 3300009036 Bacteria 3143
32 Ga0105243_10004879 3300009148 Bacteria 10525
33 Ga0105248_10189611 3300009177 Bacteria 2317
34 Ga0105238_10188796 3300009551 Bacteria 2037
35 Ga0105239_10191221 3300010375 Bacteria 2291
36 Ga0105239_10300767 3300010375 Bacteria 1807
37 Ga0157375_10409318 3300013308 Bacteria 1522
38 Ga0163163_10125955 3300014325 Bacteria 2600
39 Ga0157377_10000235 3300014745 Bacteria 28671
40 Ga0157376_10446958 3300014969 Bacteria 1260
41 Ga0209437_101167 3300025233 Bacteria 7807
42 Ga0207655_1036562 3300025728 Bacteria 2175
43 Ga0207684_10063667 3300025910 Bacteria 3131
44 Ga0207663_10044236 3300025916 Bacteria 2732
45 Ga0207660_10177105 3300025917 Bacteria 1654
46 Ga0207646_10032511 3300025922 Bacteria 4722
47 Ga0207681_10049381 3300025923 Bacteria 2844
48 Ga0207650_10149303 3300025925 Bacteria 1843
49 Ga0207659_10121586 3300025926 Bacteria 2001
50 Ga0207664_10311612 3300025929 Bacteria 1387
51 Ga0207644_10155002 3300025931 Bacteria 1776
52 Ga0207670_10182794 3300025936 Bacteria 1580
53 Ga0207667_10416256 3300025949 Bacteria 1368
54 Ga0207651_10065309 3300025960 Bacteria 2552
55 Ga0207677_10046617 3300026023 Bacteria 2903
56 Ga0207703_10010758 3300026035 Bacteria 7139
57 Ga0207678_10032989 3300026067 Bacteria 4512
58 Ga0207676_10119844 3300026095 Bacteria 2217
59 Ga0207698_10003785 3300026142 Bacteria 9148
60 Ga0265339_10020103 3300031249 Bacteria 3906
61 Ga0265327_10007647 3300031251 Bacteria 8280
62 Ga0265327_10011330 3300031251 Bacteria 6154
63 Ga0265327_10014018 3300031251 Bacteria 5278
64 Ga0265327_10024241 3300031251 Bacteria 3571
65 Ga0307408_100045522 3300031548 Bacteria 3134
66 Ga0307408_100063094 3300031548 Bacteria 2709
67 Ga0316579_10077323 3300031691 Bacteria 1582
68 Ga0316576_10051307 3300031727 Bacteria 3002
69 Ga0316578_10017369 3300031728 Bacteria 3913
70 Ga0307405_10001674 3300031731 Bacteria 9443
71 Ga0307413_10010637 3300031824 Bacteria 4479
72 Ga0307410_10014769 3300031852 Bacteria 4608
73 Ga0307406_10010179 3300031901 Bacteria 5299
74 Ga0307412_10003128 3300031911 Bacteria 9194
75 Ga0307412_10011990 3300031911 Bacteria 5034
76 Ga0307409_100011746 3300031995 Bacteria 5541
77 Ga0307416_100006212 3300032002 Bacteria 7453
78 Ga0307411_10000075 3300032005 Bacteria 30505
79 Ga0307411_10107496 3300032005 Bacteria 1988
80 Ga0307415_100004312 3300032126 Bacteria 7364
81 Ga0316574_0014516 3300035398 Bacteria 4554
82 Ga0316574_0079785 3300035398 Bacteria 2076
83 Ga0373935_0008156 3300035692 Bacteria 6278
84 Ga0373933_0006934 3300035724 Bacteria 6176
85 Ga0373947_0072387 3300035725 Bacteria 2116
86 Ga0373937_0016781 3300036401 Bacteria 6510
87 Ga0316582_0033534 3300036647 Bacteria 3155
88 Ga0316584_0199388 3300036712 Bacteria 1477
89 Ga0316584_0244577 3300036712 Bacteria 1312
90 Ga0373925_0029306 3300037068 Bacteria 4038
91 Ga0395899_0012658 3300037312 Bacteria 6465
92 Ga0395900_0028134 3300037418 Bacteria 5756
93 Ga0395898_0025248 3300037466 Bacteria 5990
94 Ga0395905_0004423 3300037471 Bacteria 14604
95 Ga0395901_0098191 3300038443 Bacteria 3070
96 Ga0436365_0027638 3300039437 Bacteria 7708
97 Ga0466969_0007802 3300044656 Bacteria 5689
98 Ga0466972_0002203 3300044658 Bacteria 9563
99 Ga0453683_0034279 3300044673 Bacteria 3201
100 Ga0466965_0013013 3300044683 Bacteria 3919
101 Ga0466961_0032113 3300044693 Bacteria 3374
102 Ga0466963_0090572 3300044694 Bacteria 2083
103 Ga0466963_0160576 3300044694 Bacteria 1564
104 Ga0466971_0006253 3300044719 Bacteria 5176
105 Ga0466968_0004604 3300044735 Bacteria 5161
106 Ga0466968_0007633 3300044735 Bacteria 4119
107 Ga0466957_0008794 3300044842 Bacteria 5749
108 Ga0466960_0049039 3300044901 Bacteria 2031
109 Ga0466959_0019934 3300045049 Bacteria 4937
110 Ga0466967_0266728 3300045976 Bacteria 1639
111 Ga0495629_0176409 3300046459 Bacteria 1482
112 Ga0495641_0092385 3300046461 Bacteria 1352
113 Ga0495651_0087251 3300046462 Bacteria 2346
114 Ga0495653_0078207 3300046463 Bacteria 2454
115 Ga0495580_0197372 3300046472 Bacteria 1387
116 Ga0495582_0025815 3300046473 Bacteria 3219
117 Ga0495608_0023146 3300046511 Bacteria 4259
118 Ga0495608_0049503 3300046511 Bacteria 2790
119 Ga0495630_0139757 3300046517 Bacteria 1841
120 Ga0495652_0099376 3300046529 Bacteria 2363
121 Ga0495586_0004730 3300046535 Bacteria 7276
122 Ga0495587_0041528 3300046536 Bacteria 2744
123 Ga0495667_0005062 3300046559 Bacteria 8914
124 Ga0495635_0094222 3300046663 Bacteria 2047
125 Ga0495588_0002307 3300046674 Bacteria 8162
126 Ga0495657_0009823 3300046675 Bacteria 7223
127 Ga0495600_0038001 3300046809 Bacteria 3131
128 Ga0495600_0124612 3300046809 Bacteria 1676
129 Ga0495604_0046059 3300047317 Bacteria 3401
130 Ga0495674_0029554 3300047319 Bacteria 4989
131 Ga0495680_0008460 3300047322 Bacteria 9347
132 Ga0495680_0294331 3300047322 Bacteria 1141
133 Ga0495593_0052133 3300047673 Bacteria 2163
134 Ga0495602_0031982 3300048088 Bacteria 4962
135 Ga0495602_0275889 3300048088 Bacteria 1241
136 Ga0496101_0254660 3300048904 Bacteria 1368
137 Ga0496102_0070918 3300048905 Bacteria 3199
138 Ga0496103_0017142 3300048906 Bacteria 4331
139 Ga0496104_0382004 3300048907 Bacteria 1321
140 Ga0496108_0029925 3300048911 Bacteria 4513
141 Ga0496108_0040956 3300048911 Bacteria 3865
142 Ga0496109_0307127 3300048912 Bacteria 1496
143 Ga0496112_0003035 3300048915 Bacteria 13729
144 Ga0496112_0011964 3300048915 Bacteria 7953
145 Ga0496112_0013662 3300048915 Bacteria 7503
146 Ga0496114_0101808 3300048917 Bacteria 2453
147 Ga0496122_0003006 3300048925 Bacteria 22920
148 Ga0496123_0002306 3300048926 Bacteria 23967
149 Ga0496125_0007305 3300048928 Bacteria 11765
150 Ga0496126_0000039 3300048929 Bacteria 347353
151 Ga0496126_0004546 3300048929 Bacteria 16493
152 Ga0501300_002688 3300049523 Bacteria 2662
153 Ga0501033_0001758 3300049570 Bacteria 18941
154 Ga0501034_0005063 3300049571 Bacteria 14479
155 Ga0501038_0015301 3300049574 Bacteria 6974
156 Ga0501043_0170975 3300049579 Bacteria 1695
157 Ga0501046_0018100 3300049580 Bacteria 5868
158 Ga0501047_0002769 3300049581 Bacteria 16663
159 Ga0501047_0007717 3300049581 Bacteria 10131
160 Ga0501047_0134668 3300049581 Bacteria 2351
161 Ga0501047_0220473 3300049581 Bacteria 1753
162 Ga0501070_0002466 3300049586 Bacteria 16203
163 Ga0501201_003971 3300049651 Bacteria 1367
164 Ga0501227_017843 3300049665 Bacteria 1606
165 Ga0501235_009126 3300049669 Bacteria 2166
166 Ga0501258_002275 3300049687 Bacteria 1668
167 Ga0501080_0030607 3300049742 Bacteria 5016
168 Ga0501044_0000422 3300049823 Bacteria 52278
169 Ga0501044_0015454 3300049823 Bacteria 8221
170 Ga0501044_0072343 3300049823 Bacteria 3505
171 nmdc:mga03n38_13282_c1 3300050490 Bacteria 3123
172 nmdc:mga03n38_1540_c1 3300050490 Bacteria 6680
173 nmdc:mga03n38_47141_c1 3300050490 Bacteria 1906
174 nmdc:mga00v17_67405_c1 3300050491 Bacteria 2211
175 nmdc:mga0yw44_24938_c1 3300050492 Bacteria 3392
176 nmdc:mga0k408_17159_c1 3300050493 Bacteria 4029
177 nmdc:mga08y16_241007_c1 3300050511 Bacteria 1869
178 Ga0495601_0027242 3300053077 Bacteria 3533
179 Ga0495595_0040947 3300053084 Bacteria 2118
180 Ga0495619_0029753 3300053085 Bacteria 3531
181 Ga0500566_0001950 3300053094 Bacteria 12141
182 Ga0500568_0000011 3300053139 Bacteria 248947
183 Ga0466962_0006386 3300061719 Bacteria 5658
184 2643739760 2643221543 Bacteria 6628015
185 2644221684 2643221639 Bacteria 6649903
186 2739058536 2738541337 Bacteria 6183410
187 2775658091 2775506735 Bacteria 4556596
188 2808852291 2808606360 Bacteria 4404006
189 2808879437 2808606366 Bacteria 4415912
190 2821113820 2821111986 Bacteria 6894338
191 2864733914 2864733723 Bacteria 6770668
192 2884793750 2884791551 Bacteria 8511252
193 2889044573 2889042446 Bacteria 7618936
194 2904491460 2904490793 Bacteria 7046938
195 2915610189 2915606848 Bacteria 6032732
196 2919054778 2919051321 Bacteria 4210889
197 2919160719 2919160200 Bacteria 6929020
198 2931388008 2931384279 Bacteria 7299545
199 2939681633 2939679117 Bacteria 6921672
200 2945993386 2945991243 Bacteria 7008369
201 2946056140 2946053406 Bacteria 6978655
202 2984530825 2984527788 Bacteria 5288478
203 2984536934 2984532647 Bacteria 5288506
204 8002780239 8002775197 Bacteria 10728764
205 Ga0436365_0898433
206 Ga0065714_10070496
207 Ga0070676_10110906
208 Ga0070683_100033059
209 Ga0070670_100018284
210 Ga0070682_100045770
211 Ga0068868_100116043
212 Ga0070669_100056939
213 Ga0070675_100026718
214 Ga0070671_100018650
215 Ga0070714_100355124
216 Ga0070708_100137362
217 Ga0070706_100084244
218 Ga0070707_100016663
219 Ga0068855_100099097
220 Ga0068854_100197739
221 Ga0068858_100015167
222 Ga0081455_10085932
223 Ga0081539_10022196
224 Ga0075365_10138738
225 Ga0075363_100000172
226 Ga0075363_100028185
227 Ga0075363_100054038
228 Ga0075363_100111234
229 Ga0075364_10099730
230 Ga0075364_10143933
231 Ga0075367_10114400
232 Ga0075435_100091392
233 Ga0099794_10012306
234 Ga0105244_10005997
235 Ga0105244_10026415
236 Ga0105243_10004879
237 Ga0105248_10189611
238 Ga0105238_10188796
239 Ga0105239_10191221
240 Ga0105239_10300767
241 Ga0157375_10409318
242 Ga0163163_10125955
243 Ga0157377_10000235
244 Ga0157376_10446958
245 Ga0209437_101167
246 Ga0207655_1036562
247 Ga0207684_10063667
248 Ga0207663_10044236
249 Ga0207660_10177105
250 Ga0207646_10032511
251 Ga0207681_10049381
252 Ga0207650_10149303
253 Ga0207659_10121586
254 Ga0207664_10311612
255 Ga0207644_10155002
256 Ga0207670_10182794
257 Ga0207667_10416256
258 Ga0207651_10065309
259 Ga0207677_10046617
260 Ga0207703_10010758
261 Ga0207678_10032989
262 Ga0207676_10119844
263 Ga0207698_10003785
264 Ga0265339_10020103
265 Ga0265327_10007647
266 Ga0265327_10011330
267 Ga0265327_10014018
268 Ga0265327_10024241
269 Ga0307408_100045522
270 Ga0307408_100063094
271 Ga0316579_10077323
272 Ga0316576_10051307
273 Ga0316578_10017369
274 Ga0307405_10001674
275 Ga0307413_10010637
276 Ga0307410_10014769
277 Ga0307406_10010179
278 Ga0307412_10003128
279 Ga0307412_10011990
280 Ga0307409_100011746
281 Ga0307416_100006212
282 Ga0307411_10000075
283 Ga0307411_10107496
284 Ga0307415_100004312
285 Ga0316574_0014516
286 Ga0316574_0079785
287 Ga0373935_0008156
288 Ga0373933_0006934
289 Ga0373947_0072387
290 Ga0373937_0016781
291 Ga0316582_0033534
292 Ga0316584_0199388
293 Ga0316584_0244577
294 Ga0373925_0029306
295 Ga0395899_0012658
296 Ga0395900_0028134
297 Ga0395898_0025248
298 Ga0395905_0004423
299 Ga0395901_0098191
300 Ga0436365_0027638
301 Ga0466969_0007802
302 Ga0466972_0002203
303 Ga0453683_0034279
304 Ga0466965_0013013
305 Ga0466961_0032113
306 Ga0466963_0090572
307 Ga0466963_0160576
308 Ga0466971_0006253
309 Ga0466968_0004604
310 Ga0466968_0007633
311 Ga0466957_0008794
312 Ga0466960_0049039
313 Ga0466959_0019934
314 Ga0466967_0266728
315 Ga0495629_0176409
316 Ga0495641_0092385
317 Ga0495651_0087251
318 Ga0495653_0078207
319 Ga0495580_0197372
320 Ga0495582_0025815
321 Ga0495608_0023146
322 Ga0495608_0049503
323 Ga0495630_0139757
324 Ga0495652_0099376
325 Ga0495586_0004730
326 Ga0495587_0041528
327 Ga0495667_0005062
328 Ga0495635_0094222
329 Ga0495588_0002307
330 Ga0495657_0009823
331 Ga0495600_0038001
332 Ga0495600_0124612
333 Ga0495604_0046059
334 Ga0495674_0029554
335 Ga0495680_0008460
336 Ga0495680_0294331
337 Ga0495593_0052133
338 Ga0495602_0031982
339 Ga0495602_0275889
340 Ga0496101_0254660
341 Ga0496102_0070918
342 Ga0496103_0017142
343 Ga0496104_0382004
344 Ga0496108_0029925
345 Ga0496108_0040956
346 Ga0496109_0307127
347 Ga0496112_0003035
348 Ga0496112_0011964
349 Ga0496112_0013662
350 Ga0496114_0101808
351 Ga0496122_0003006
352 Ga0496123_0002306
353 Ga0496125_0007305
354 Ga0496126_0000039
355 Ga0496126_0004546
356 Ga0501300_002688
357 Ga0501033_0001758
358 Ga0501034_0005063
359 Ga0501038_0015301
360 Ga0501043_0170975
361 Ga0501046_0018100
362 Ga0501047_0002769
363 Ga0501047_0007717
364 Ga0501047_0134668
365 Ga0501047_0220473
366 Ga0501070_0002466
367 Ga0501201_003971
368 Ga0501227_017843
369 Ga0501235_009126
370 Ga0501258_002275
371 Ga0501080_0030607
372 Ga0501044_0000422
373 Ga0501044_0015454
374 Ga0501044_0072343
375 nmdc:mga03n38_13282_c1
376 nmdc:mga03n38_1540_c1
377 nmdc:mga03n38_47141_c1
378 nmdc:mga00v17_67405_c1
379 nmdc:mga0yw44_24938_c1
380 nmdc:mga0k408_17159_c1
381 nmdc:mga08y16_241007_c1
382 Ga0495601_0027242
383 Ga0495595_0040947
384 Ga0495619_0029753
385 Ga0500566_0001950
386 Ga0500568_0000011
387 Ga0466962_0006386
388 2643739760
389 2644221684
390 2739058536
391 2775658091
392 2808852291
393 2808879437
394 2821113820
395 2864733914
396 2884793750
397 2889044573
398 2904491460
399 2915610189
400 2919054778
401 2919160719
402 2931388008
403 2939681633
404 2945993386
405 2946056140
406 2984530825
407 2984536934
408 8002780239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

182

427

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9496 11 386
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9445 11 386
2xkr-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis cyp142: a novel cholesterol oxidase 0.9436 15 388
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.9367 12 385
3ejb-assembly4.cif.gz_H crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein 0.9367 12 385
ID Description Score Start End Superfamily
af_P9WPP5_7_402_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.947 12 388 1.10.630.10
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9367 12 385 1.10.630.10
5vwsA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9348 13 386 1.10.630.10
3ejbD02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9318 61 386 1.10.630.10
3zbyA00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.929 17 388 1.10.630.10
ID Description Score Start End GO Terms
AF-E5WLF8-F1-model_v4 deleted 0.9766 203 388
AF-A0A1H7X6N2-F1-model_v4 Cytochrome P450 0.9709 179 388 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A5M9TK95-F1-model_v4 Cytochrome P450 0.9698 244 354 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A534PBB6-F1-model_v4 Cytochrome P450 0.9694 219 388 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A535FFD0-F1-model_v4 Cytochrome P450 0.9688 127 388 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Map