F312587

General Info

Members Datasets Scaffolds Average Seq Length
204 143 408 325

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000668|Ga0213875_1000066817
Length 360
Sequence MLNNVAVVALDRIEAFELGVVCEVFGLDRSDDGLPVYDFAVVAGEPGPIRCNAGFTITAPYDLSRLEEADLIAVPAVSDRRLGDPQRIPGLSPHPLPPDRFLPELLARGPAETGRFPEDLLDALRRAVDRGAWVVSVCSGVFILGEAGLLDGRRCTTHWRHAAELSRRYPRAIVDPHVLYVDEEPIITSAGTGAGIDACLHLVRKVQGSRVANGIARRMVVPPHREGGQAQYINRPLGESPSGSLAPILDWMALHLDQPLSVADLADRAHMSPRTFARKFTQETGTTPLRWLTSQRVLLAQQLLEDTDETVDAIADHAGFGNAAALRHHFRAWRDTTPDAYRRLFRGPDQVAEREPVPVG

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
126 2643221578 Streptomyces sp. Root63 Isolate Unclassified
127 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
128 2643221613 Oerskovia sp. Root22 Isolate Unclassified
129 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
130 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
131 2643221721 Oerskovia sp. Root918 Isolate Unclassified
132 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
133 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
134 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
135 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
136 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
137 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
138 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
139 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
140 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
141 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
142 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
143 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.69
Metatranscriptomes 0
Isolates 9.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 3.92
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000668 3300021388 Bacteria 27084
2 JGI24738J21930_10009342 3300002075 Bacteria 2209
3 JGI25406J46586_10014460 3300003203 Bacteria 3355
4 rootH1_10003237 3300003323 Bacteria 18053
5 Ga0070682_100053185 3300005337 Bacteria 2537
6 Ga0070660_100315298 3300005339 Bacteria 1284
7 Ga0070671_100010993 3300005355 Bacteria 7263
8 Ga0070667_100010491 3300005367 Bacteria 7651
9 Ga0070714_100000008 3300005435 Bacteria 278734
10 Ga0070700_100114313 3300005441 Bacteria 1799
11 Ga0068853_100026784 3300005539 Bacteria 4843
12 Ga0070665_100002494 3300005548 Bacteria 20259
13 Ga0068863_100002894 3300005841 Bacteria 17005
14 Ga0068858_100004333 3300005842 Bacteria 13926
15 Ga0068860_100000017 3300005843 Bacteria 307083
16 Ga0081539_10000125 3300005985 Bacteria 180646
17 Ga0075368_10041681 3300006042 Bacteria 1804
18 Ga0075362_10019525 3300006177 Bacteria 2820
19 Ga0075367_10002013 3300006178 Bacteria 9071
20 Ga0105240_10153286 3300009093 Bacteria 2743
21 Ga0111539_10174032 3300009094 Bacteria 2514
22 Ga0105243_10123757 3300009148 Bacteria 2185
23 Ga0105248_10525022 3300009177 Bacteria 1335
24 Ga0105249_10191889 3300009553 Bacteria 1994
25 Ga0105246_10008207 3300011119 Bacteria 6414
26 Ga0157370_10159900 3300013104 Bacteria 2096
27 Ga0157369_10784376 3300013105 Bacteria 979
28 Ga0157372_10002683 3300013307 Bacteria 19253
29 Ga0157379_10266532 3300014968 Bacteria 1557
30 Ga0182007_10000456 3300015262 Bacteria 24668
31 Ga0213874_10050578 3300021377 Bacteria 1274
32 Ga0207688_10020947 3300025901 Bacteria 3569
33 Ga0207688_10099586 3300025901 Bacteria 1677
34 Ga0207680_10042151 3300025903 Bacteria 2668
35 Ga0207647_10011862 3300025904 Bacteria 6089
36 Ga0207695_10102884 3300025913 Bacteria 2848
37 Ga0207694_10018954 3300025924 Bacteria 5201
38 Ga0207664_10000002 3300025929 Bacteria 657053
39 Ga0207668_10285468 3300025972 Bacteria 1355
40 Ga0207658_10003360 3300025986 Bacteria 11344
41 Ga0207703_10006250 3300026035 Bacteria 9525
42 Ga0207639_10160676 3300026041 Bacteria 1893
43 Ga0207702_10076142 3300026078 Bacteria 2900
44 Ga0207674_10284913 3300026116 Bacteria 1600
45 Ga0268266_10000281 3300028379 Bacteria 83806
46 Ga0268264_10000033 3300028381 Bacteria 404123
47 Ga0307515_10000167 3300028794 Bacteria 160820
48 Ga0307515_10014639 3300028794 Bacteria 14522
49 Ga0307515_10022147 3300028794 Bacteria 11215
50 Ga0307515_10184577 3300028794 Bacteria 2021
51 Ga0307515_10185919 3300028794 Bacteria 2007
52 Ga0307512_10009167 3300030522 Bacteria 9561
53 Ga0307512_10010710 3300030522 Bacteria 8723
54 Ga0307512_10063095 3300030522 Bacteria 2836
55 Ga0307513_10000126 3300031456 Bacteria 107665
56 Ga0307513_10006497 3300031456 Bacteria 15271
57 Ga0307513_10027728 3300031456 Bacteria 6494
58 Ga0307513_10060452 3300031456 Bacteria 4017
59 Ga0307508_10006522 3300031616 Bacteria 10971
60 Ga0307508_10028130 3300031616 Bacteria 5085
61 Ga0307516_10000550 3300031730 Bacteria 50318
62 Ga0307518_10147167 3300031838 Bacteria 1634
63 Ga0307416_100231981 3300032002 Bacteria 1780
64 Ga0307415_100436662 3300032126 Bacteria 1128
65 Ga0436364_0407051 3300037853 Bacteria 2012
66 Ga0436364_0833483 3300037853 Bacteria 70774
67 Ga0395901_0092579 3300038443 Bacteria 3164
68 Ga0439436_0029517 3300041404 Bacteria 1597
69 Ga0439433_0009878 3300041999 Bacteria 2083
70 Ga0439449_0005664 3300042007 Bacteria 4777
71 Ga0439457_000093 3300042014 Bacteria 20439
72 Ga0466966_0001284 3300044684 Bacteria 16075
73 Ga0466961_0163892 3300044693 Bacteria 1385
74 Ga0466963_0096640 3300044694 Bacteria 2018
75 Ga0466968_0112616 3300044735 Bacteria 1225
76 Ga0466970_0116572 3300044765 Bacteria 1461
77 Ga0466960_0034614 3300044901 Bacteria 2355
78 Ga0466959_0008142 3300045049 Bacteria 7394
79 Ga0466959_0030596 3300045049 Bacteria 3987
80 Ga0466967_0129948 3300045976 Bacteria 2337
81 Ga0466967_0233457 3300045976 Bacteria 1752
82 Ga0495592_0038061 3300046454 Bacteria 3620
83 Ga0495603_0000850 3300046455 Bacteria 17499
84 Ga0495603_0002372 3300046455 Bacteria 11064
85 Ga0495603_0010891 3300046455 Bacteria 5518
86 Ga0495603_0017899 3300046455 Bacteria 4288
87 Ga0495603_0042115 3300046455 Bacteria 2730
88 Ga0495629_0002039 3300046459 Bacteria 15693
89 Ga0495629_0022197 3300046459 Bacteria 4527
90 Ga0495629_0027529 3300046459 Bacteria 4036
91 Ga0495629_0043052 3300046459 Bacteria 3171
92 Ga0495653_0004947 3300046463 Bacteria 10818
93 Ga0495639_0006671 3300046475 Bacteria 4968
94 Ga0495662_0017095 3300046476 Bacteria 3511
95 Ga0495585_0045745 3300046492 Bacteria 2442
96 Ga0495594_0004975 3300046499 Bacteria 6839
97 Ga0495594_0164302 3300046499 Bacteria 1262
98 Ga0495583_0016768 3300046506 Bacteria 3920
99 Ga0495628_0079393 3300046516 Bacteria 2551
100 Ga0495630_0066945 3300046517 Bacteria 2700
101 Ga0495652_0105460 3300046529 Bacteria 2277
102 Ga0495640_0011666 3300046533 Bacteria 6746
103 Ga0495640_0076657 3300046533 Bacteria 2231
104 Ga0495645_0001584 3300046543 Bacteria 15398
105 Ga0495588_0003547 3300046674 Bacteria 6811
106 Ga0495657_0011010 3300046675 Bacteria 6784
107 Ga0495613_0001483 3300046689 Bacteria 17894
108 Ga0495613_0002320 3300046689 Bacteria 14418
109 Ga0495670_0006918 3300046691 Bacteria 5587
110 Ga0495589_0005602 3300046794 Bacteria 6623
111 Ga0495600_0005811 3300046809 Bacteria 7456
112 Ga0495581_0013727 3300047315 Bacteria 4697
113 Ga0495604_0003620 3300047317 Bacteria 12321
114 Ga0495604_0004743 3300047317 Bacteria 10772
115 Ga0495636_0009561 3300047318 Bacteria 3818
116 Ga0495636_0026674 3300047318 Bacteria 2351
117 Ga0495676_0000897 3300047321 Bacteria 24870
118 Ga0495676_0002047 3300047321 Bacteria 17746
119 Ga0495676_0037165 3300047321 Bacteria 4056
120 Ga0495676_0172626 3300047321 Bacteria 1520
121 Ga0495687_005878 3300047443 Bacteria 7675
122 Ga0495687_055480 3300047443 Bacteria 1656
123 Ga0495675_0054808 3300047444 Bacteria 2529
124 Ga0495685_001484 3300047447 Bacteria 7183
125 Ga0495685_017040 3300047447 Bacteria 2485
126 Ga0495614_0003234 3300048089 Bacteria 7273
127 Ga0496106_0117891 3300048909 Bacteria 2072
128 Ga0496108_0138544 3300048911 Bacteria 2096
129 Ga0496109_0077161 3300048912 Bacteria 3066
130 Ga0496110_0075311 3300048913 Bacteria 2999
131 Ga0496112_0053053 3300048915 Bacteria 3981
132 Ga0496113_0024437 3300048916 Bacteria 4295
133 Ga0496114_0073027 3300048917 Bacteria 2887
134 Ga0496114_0162770 3300048917 Bacteria 1941
135 Ga0501031_0034918 3300049568 Bacteria 3281
136 Ga0501031_0074498 3300049568 Bacteria 2210
137 Ga0501032_0048491 3300049569 Bacteria 2867
138 Ga0501032_0048765 3300049569 Bacteria 2859
139 Ga0501032_0050993 3300049569 Bacteria 2790
140 Ga0501033_0004668 3300049570 Bacteria 10967
141 Ga0501033_0008571 3300049570 Bacteria 7911
142 Ga0501033_0080941 3300049570 Bacteria 2382
143 Ga0501033_0182643 3300049570 Bacteria 1503
144 Ga0501034_0017363 3300049571 Bacteria 7380
145 Ga0501034_0018154 3300049571 Bacteria 7216
146 Ga0501034_0020250 3300049571 Bacteria 6793
147 Ga0501036_0015467 3300049572 Bacteria 6374
148 Ga0501036_0029203 3300049572 Bacteria 4661
149 Ga0501037_0039064 3300049573 Bacteria 3495
150 Ga0501037_0157121 3300049573 Bacteria 1622
151 Ga0501038_0007355 3300049574 Bacteria 10160
152 Ga0501038_0050897 3300049574 Bacteria 3578
153 Ga0501039_0029193 3300049575 Bacteria 4247
154 Ga0501039_0033560 3300049575 Bacteria 3958
155 Ga0501042_0023037 3300049578 Bacteria 4353
156 Ga0501043_0001624 3300049579 Bacteria 19569
157 Ga0501043_0003401 3300049579 Bacteria 13081
158 Ga0501046_0002484 3300049580 Bacteria 17280
159 Ga0501047_0000518 3300049581 Bacteria 41734
160 Ga0501047_0015227 3300049581 Bacteria 7325
161 Ga0501047_0034876 3300049581 Bacteria 4857
162 Ga0501047_0105574 3300049581 Bacteria 2697
163 Ga0501047_0169571 3300049581 Bacteria 2052
164 Ga0501048_0003125 3300049582 Bacteria 12644
165 Ga0501070_0001890 3300049586 Bacteria 18511
166 Ga0501070_0070768 3300049586 Bacteria 2888
167 Ga0501073_0071922 3300049589 Bacteria 2409
168 Ga0501074_0004320 3300049590 Bacteria 10148
169 Ga0501080_0026441 3300049742 Bacteria 5392
170 Ga0501080_0056771 3300049742 Bacteria 3645
171 Ga0501080_0421679 3300049742 Bacteria 1199
172 Ga0501035_0008516 3300049822 Bacteria 9549
173 Ga0501035_0016255 3300049822 Bacteria 6866
174 Ga0501035_0018772 3300049822 Bacteria 6369
175 Ga0501035_0035494 3300049822 Bacteria 4524
176 Ga0501035_0111314 3300049822 Bacteria 2399
177 Ga0501035_0138697 3300049822 Bacteria 2115
178 Ga0501044_0010613 3300049823 Bacteria 9992
179 Ga0501044_0038588 3300049823 Bacteria 4987
180 Ga0501044_0065122 3300049823 Bacteria 3717
181 Ga0501044_0241443 3300049823 Bacteria 1750
182 Ga0501044_0267512 3300049823 Bacteria 1646
183 nmdc:mga03683_24735_c1 3300050489 Bacteria 2352
184 nmdc:mga00v17_4071_c1 3300050491 Bacteria 7557
185 nmdc:mga06z11_665_c1 3300050494 Bacteria 12505
186 2616900053 2616644941 Bacteria 8510691
187 2643902415 2643221578 Bacteria 9213798
188 2644017582 2643221601 Bacteria 7493239
189 2644082931 2643221613 Bacteria 4622396
190 2644173458 2643221631 Bacteria 8168043
191 2644403986 2643221673 Bacteria 9196637
192 2644665888 2643221721 Bacteria 4486924
193 2739366817 2738543034 Bacteria 6084756
194 2808913446 2808606375 Bacteria 9466072
195 2819694755 2818991463 Bacteria 7948711
196 2875396540 2875391855 Bacteria 7600475
197 2904769253 2904765812 Bacteria 5369154
198 2904776299 2904770941 Bacteria 5580202
199 2908814385 2908811453 Bacteria 5478616
200 2919422826 2919420072 Bacteria 5390363
201 2919434921 2919432681 Bacteria 5390474
202 2935891681 2935890801 Bacteria 4593001
203 2946048014 2946045630 Bacteria 8527308
204 2966600990 2966598605 Bacteria 7676064
205 Ga0213875_10000668
206 JGI24738J21930_10009342
207 JGI25406J46586_10014460
208 rootH1_10003237
209 Ga0070682_100053185
210 Ga0070660_100315298
211 Ga0070671_100010993
212 Ga0070667_100010491
213 Ga0070714_100000008
214 Ga0070700_100114313
215 Ga0068853_100026784
216 Ga0070665_100002494
217 Ga0068863_100002894
218 Ga0068858_100004333
219 Ga0068860_100000017
220 Ga0081539_10000125
221 Ga0075368_10041681
222 Ga0075362_10019525
223 Ga0075367_10002013
224 Ga0105240_10153286
225 Ga0111539_10174032
226 Ga0105243_10123757
227 Ga0105248_10525022
228 Ga0105249_10191889
229 Ga0105246_10008207
230 Ga0157370_10159900
231 Ga0157369_10784376
232 Ga0157372_10002683
233 Ga0157379_10266532
234 Ga0182007_10000456
235 Ga0213874_10050578
236 Ga0207688_10020947
237 Ga0207688_10099586
238 Ga0207680_10042151
239 Ga0207647_10011862
240 Ga0207695_10102884
241 Ga0207694_10018954
242 Ga0207664_10000002
243 Ga0207668_10285468
244 Ga0207658_10003360
245 Ga0207703_10006250
246 Ga0207639_10160676
247 Ga0207702_10076142
248 Ga0207674_10284913
249 Ga0268266_10000281
250 Ga0268264_10000033
251 Ga0307515_10000167
252 Ga0307515_10014639
253 Ga0307515_10022147
254 Ga0307515_10184577
255 Ga0307515_10185919
256 Ga0307512_10009167
257 Ga0307512_10010710
258 Ga0307512_10063095
259 Ga0307513_10000126
260 Ga0307513_10006497
261 Ga0307513_10027728
262 Ga0307513_10060452
263 Ga0307508_10006522
264 Ga0307508_10028130
265 Ga0307516_10000550
266 Ga0307518_10147167
267 Ga0307416_100231981
268 Ga0307415_100436662
269 Ga0436364_0407051
270 Ga0436364_0833483
271 Ga0395901_0092579
272 Ga0439436_0029517
273 Ga0439433_0009878
274 Ga0439449_0005664
275 Ga0439457_000093
276 Ga0466966_0001284
277 Ga0466961_0163892
278 Ga0466963_0096640
279 Ga0466968_0112616
280 Ga0466970_0116572
281 Ga0466960_0034614
282 Ga0466959_0008142
283 Ga0466959_0030596
284 Ga0466967_0129948
285 Ga0466967_0233457
286 Ga0495592_0038061
287 Ga0495603_0000850
288 Ga0495603_0002372
289 Ga0495603_0010891
290 Ga0495603_0017899
291 Ga0495603_0042115
292 Ga0495629_0002039
293 Ga0495629_0022197
294 Ga0495629_0027529
295 Ga0495629_0043052
296 Ga0495653_0004947
297 Ga0495639_0006671
298 Ga0495662_0017095
299 Ga0495585_0045745
300 Ga0495594_0004975
301 Ga0495594_0164302
302 Ga0495583_0016768
303 Ga0495628_0079393
304 Ga0495630_0066945
305 Ga0495652_0105460
306 Ga0495640_0011666
307 Ga0495640_0076657
308 Ga0495645_0001584
309 Ga0495588_0003547
310 Ga0495657_0011010
311 Ga0495613_0001483
312 Ga0495613_0002320
313 Ga0495670_0006918
314 Ga0495589_0005602
315 Ga0495600_0005811
316 Ga0495581_0013727
317 Ga0495604_0003620
318 Ga0495604_0004743
319 Ga0495636_0009561
320 Ga0495636_0026674
321 Ga0495676_0000897
322 Ga0495676_0002047
323 Ga0495676_0037165
324 Ga0495676_0172626
325 Ga0495687_005878
326 Ga0495687_055480
327 Ga0495675_0054808
328 Ga0495685_001484
329 Ga0495685_017040
330 Ga0495614_0003234
331 Ga0496106_0117891
332 Ga0496108_0138544
333 Ga0496109_0077161
334 Ga0496110_0075311
335 Ga0496112_0053053
336 Ga0496113_0024437
337 Ga0496114_0073027
338 Ga0496114_0162770
339 Ga0501031_0034918
340 Ga0501031_0074498
341 Ga0501032_0048491
342 Ga0501032_0048765
343 Ga0501032_0050993
344 Ga0501033_0004668
345 Ga0501033_0008571
346 Ga0501033_0080941
347 Ga0501033_0182643
348 Ga0501034_0017363
349 Ga0501034_0018154
350 Ga0501034_0020250
351 Ga0501036_0015467
352 Ga0501036_0029203
353 Ga0501037_0039064
354 Ga0501037_0157121
355 Ga0501038_0007355
356 Ga0501038_0050897
357 Ga0501039_0029193
358 Ga0501039_0033560
359 Ga0501042_0023037
360 Ga0501043_0001624
361 Ga0501043_0003401
362 Ga0501046_0002484
363 Ga0501047_0000518
364 Ga0501047_0015227
365 Ga0501047_0034876
366 Ga0501047_0105574
367 Ga0501047_0169571
368 Ga0501048_0003125
369 Ga0501070_0001890
370 Ga0501070_0070768
371 Ga0501073_0071922
372 Ga0501074_0004320
373 Ga0501080_0026441
374 Ga0501080_0056771
375 Ga0501080_0421679
376 Ga0501035_0008516
377 Ga0501035_0016255
378 Ga0501035_0018772
379 Ga0501035_0035494
380 Ga0501035_0111314
381 Ga0501035_0138697
382 Ga0501044_0010613
383 Ga0501044_0038588
384 Ga0501044_0065122
385 Ga0501044_0241443
386 Ga0501044_0267512
387 nmdc:mga03683_24735_c1
388 nmdc:mga00v17_4071_c1
389 nmdc:mga06z11_665_c1
390 2616900053
391 2643902415
392 2644017582
393 2644082931
394 2644173458
395 2644403986
396 2644665888
397 2739366817
398 2808913446
399 2819694755
400 2875396540
401 2904769253
402 2904776299
403 2908814385
404 2919422826
405 2919434921
406 2935891681
407 2946048014
408 2966600990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

265

344

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

252

293

0.95

PF01965

DJ-1_PfpI

DJ-1/PfpI family

108

205

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9352 214 313
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9106 215 317
2k9s-assembly1.cif.gz_A solution structure of dna binding domain of e. coli arac 0.9078 214 311
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9072 211 321
3bhn-assembly1.cif.gz_A-2 crystal structure of a dj-1/pfpi-like protein (shew_2856) from shewanella loihica pv-4 at 1.76 a resolution 0.8999 2 191
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9714 263 314 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9686 267 312 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9562 213 315 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9488 267 312 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9439 214 311 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1V0TKT7-F1-model_v4 AraC family transcriptional regulator 0.9799 214 311 GO:0003700
GO:0043565
AF-A0A6L8Z911-F1-model_v4 deleted 0.9795 214 311
AF-A0A3D1F0J9-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9763 214 315 GO:0003700
GO:0043565
AF-A0A858REL5-F1-model_v4 AraC family transcriptional regulator 0.9713 214 315 GO:0003700
GO:0043565
AF-A0A090IYF9-F1-model_v4 DNA-binding response regulator 0.9707 214 314 GO:0000160
GO:0003700
GO:0043565

Map