F312554

General Info

Members Datasets Scaffolds Average Seq Length
204 162 204 114

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10433898|Ga0157372_104338982
Length 133
Sequence VEAPQRHPKRRLTSLLEDDNMFARLMGLGSISPAALHDLLRNEGVTVIDVNSHQSWLKAHVPGAINLDPTSWDAHDLPADKASRIVFYCSNPLCRKAPNAARRAKKLGYSNAIVMSAGIHGWVSANMPTESCR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
81 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
152 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 5.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.94
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10239055 3300003322 Bacteria 1563
2 Ga0065704_10828053 3300005289 Bacteria 516
3 Ga0065707_10147032 3300005295 Bacteria 1701
4 Ga0070676_10042964 3300005328 Bacteria 2626
5 Ga0070670_100092154 3300005331 Unclassified 2606
6 Ga0068869_100654470 3300005334 Bacteria 892
7 Ga0070682_100000082 3300005337 Bacteria 85071
8 Ga0070660_100041150 3300005339 Bacteria 3521
9 Ga0070660_100047687 3300005339 Bacteria 3288
10 Ga0070689_100021795 3300005340 Bacteria 4775
11 Ga0070668_100108732 3300005347 Bacteria 2205
12 Ga0070669_100671938 3300005353 Unclassified 873
13 Ga0070673_100627975 3300005364 Bacteria 982
14 Ga0070688_100055376 3300005365 Bacteria 2487
15 Ga0070688_100158377 3300005365 Unclassified 1554
16 Ga0070659_101466680 3300005366 Unclassified 607
17 Ga0070705_100149347 3300005440 Bacteria 1548
18 Ga0070705_101951518 3300005440 Unclassified 500
19 Ga0070694_100327120 3300005444 Unclassified 1181
20 Ga0070662_100431429 3300005457 Bacteria 1092
21 Ga0068867_101944424 3300005459 Unclassified 555
22 Ga0070685_10036436 3300005466 Bacteria 2781
23 Ga0070685_10466870 3300005466 Unclassified 887
24 Ga0070698_100085234 3300005471 Bacteria 3147
25 Ga0070698_100492257 3300005471 Unclassified 1164
26 Ga0070699_100000005 3300005518 Bacteria 384287
27 Ga0070665_100000559 3300005548 Bacteria 51888
28 Ga0070664_100480133 3300005564 Unclassified 1144
29 Ga0070702_100104718 3300005615 Bacteria 1742
30 Ga0068852_100329362 3300005616 Bacteria 1485
31 Ga0068852_100906501 3300005616 Bacteria 899
32 Ga0068870_11071739 3300005840 Bacteria 578
33 Ga0068858_100000390 3300005842 Bacteria 45908
34 Ga0068860_100098389 3300005843 Bacteria 2790
35 Ga0068862_100002128 3300005844 Bacteria 17841
36 Ga0068862_100290291 3300005844 Bacteria 1502
37 Ga0081539_10001143 3300005985 Bacteria 48071
38 Ga0097621_100027924 3300006237 Bacteria 4444
39 Ga0097621_100627067 3300006237 Unclassified 985
40 Ga0068871_100237626 3300006358 Bacteria 1583
41 Ga0075428_100070156 3300006844 Bacteria 3831
42 Ga0075428_100693600 3300006844 Unclassified 1085
43 Ga0075430_100026314 3300006846 Bacteria 4950
44 Ga0075431_100225433 3300006847 Bacteria 1911
45 Ga0075433_10022477 3300006852 Bacteria 5293
46 Ga0075433_10880162 3300006852 Unclassified 781
47 Ga0075434_100209889 3300006871 Bacteria 1967
48 Ga0075429_100874849 3300006880 Unclassified 786
49 Ga0097620_100249959 3300006931 Bacteria 1863
50 Ga0075435_100050349 3300007076 Bacteria 3352
51 Ga0075435_100054006 3300007076 Bacteria 3242
52 Ga0105240_10196482 3300009093 Bacteria 2368
53 Ga0111539_10560153 3300009094 Bacteria 1331
54 Ga0111539_10871543 3300009094 Unclassified 1047
55 Ga0105245_10001326 3300009098 Bacteria 22378
56 Ga0105245_10266005 3300009098 Bacteria 1670
57 Ga0105245_10797375 3300009098 Bacteria 982
58 Ga0105247_10171499 3300009101 Bacteria 1443
59 Ga0114129_10081690 3300009147 Bacteria 4492
60 Ga0114129_10361001 3300009147 Bacteria 1922
61 Ga0105241_10394466 3300009174 Bacteria 1212
62 Ga0105248_10119335 3300009177 Bacteria 2975
63 Ga0105248_10458580 3300009177 Bacteria 1437
64 Ga0105248_10865054 3300009177 Unclassified 1020
65 Ga0105248_11802504 3300009177 Bacteria 694
66 Ga0105237_10176962 3300009545 Bacteria 2134
67 Ga0105237_10871549 3300009545 Bacteria 907
68 Ga0105238_10663573 3300009551 Bacteria 1053
69 Ga0105249_11430644 3300009553 Unclassified 763
70 Ga0157370_10630325 3300013104 Bacteria 981
71 Ga0157378_10046790 3300013297 Bacteria 3845
72 Ga0157378_10171418 3300013297 Bacteria 2035
73 Ga0157378_10543788 3300013297 Bacteria 1166
74 Ga0157378_10557398 3300013297 Bacteria 1152
75 Ga0157372_10433898 3300013307 Bacteria 1531
76 Ga0157375_11340147 3300013308 Bacteria 842
77 Ga0157380_10331677 3300014326 Unclassified 1415
78 Ga0157380_12671466 3300014326 Bacteria 566
79 Ga0157379_11467830 3300014968 Bacteria 663
80 Ga0163161_10085357 3300017792 Bacteria 2329
81 Ga0207645_10021139 3300025907 Bacteria 4247
82 Ga0207705_10048815 3300025909 Bacteria 3046
83 Ga0207654_10626112 3300025911 Bacteria 769
84 Ga0207654_11308792 3300025911 Bacteria 528
85 Ga0207695_10018095 3300025913 Bacteria 8155
86 Ga0207693_10399346 3300025915 Unclassified 1075
87 Ga0207657_10016436 3300025919 Bacteria 7139
88 Ga0207657_10074225 3300025919 Bacteria 2873
89 Ga0207681_10290142 3300025923 Unclassified 1291
90 Ga0207650_10028368 3300025925 Unclassified 4013
91 Ga0207687_10000974 3300025927 Bacteria 19473
92 Ga0207687_10579608 3300025927 Bacteria 944
93 Ga0207690_10208554 3300025932 Bacteria 1488
94 Ga0207706_10436412 3300025933 Bacteria 1134
95 Ga0207670_10000922 3300025936 Bacteria 15467
96 Ga0207711_10039963 3300025941 Bacteria 3990
97 Ga0207711_10627413 3300025941 Unclassified 1003
98 Ga0207712_10127954 3300025961 Bacteria 1931
99 Ga0207712_10945613 3300025961 Unclassified 763
100 Ga0207668_10204652 3300025972 Bacteria 1574
101 Ga0207668_10216829 3300025972 Unclassified 1534
102 Ga0207703_10000019 3300026035 Bacteria 254885
103 Ga0207641_10772758 3300026088 Unclassified 949
104 Ga0207683_10041255 3300026121 Unclassified 4029
105 Ga0207428_10966511 3300027907 Bacteria 600
106 Ga0268265_10000564 3300028380 Bacteria 37658
107 Ga0268264_10745429 3300028381 Bacteria 975
108 Ga0265338_10042822 3300028800 Bacteria 4209
109 Ga0316212_1001907 3300033547 Unclassified 2924
110 Ga0373929_0000035 3300035085 Bacteria 38214
111 Ga0395900_0000505 3300037418 Bacteria 54923
112 Ga0395905_0242723 3300037471 Unclassified 1683
113 Ga0451789_1135778 3300041443 Bacteria 585
114 Ga0451793_0661462 3300041452 Bacteria 612
115 Ga0451798_0376302 3300041458 Unclassified 509
116 Ga0451843_0687899 3300041509 Unclassified 602
117 Ga0439450_009037 3300042008 Bacteria 1879
118 Ga0453683_0413076 3300044673 Bacteria 870
119 Ga0466966_0383696 3300044684 Bacteria 844
120 Ga0466968_0091393 3300044735 Bacteria 1349
121 Ga0466970_0422880 3300044765 Bacteria 762
122 Ga0451576_1684212 3300045051 Unclassified 657
123 Ga0466967_0016003 3300045976 Bacteria 5899
124 Ga0495592_0254935 3300046454 Bacteria 1158
125 Ga0495591_000439 3300046458 Bacteria 33866
126 Ga0495605_0032515 3300046474 Bacteria 2655
127 Ga0495584_0000413 3300046491 Bacteria 29405
128 Ga0495585_0152606 3300046492 Bacteria 1203
129 Ga0495596_0010396 3300046500 Bacteria 4053
130 Ga0495607_0000558 3300046501 Bacteria 36357
131 Ga0495583_0000856 3300046506 Bacteria 37034
132 Ga0495606_0035822 3300046507 Bacteria 3388
133 Ga0495610_0000555 3300046512 Bacteria 37362
134 Ga0495616_0018323 3300046513 Bacteria 3845
135 Ga0495616_0129249 3300046513 Bacteria 1159
136 Ga0495618_0262759 3300046514 Bacteria 1080
137 Ga0495631_0023270 3300046518 Bacteria 2872
138 Ga0495632_0013755 3300046519 Bacteria 4604
139 Ga0495637_0000014 3300046520 Bacteria 228956
140 Ga0495643_0016966 3300046522 Bacteria 4267
141 Ga0495642_0003173 3300046528 Bacteria 6521
142 Ga0495609_0204883 3300046538 Bacteria 823
143 Ga0495597_0355200 3300046542 Bacteria 562
144 Ga0495633_0006932 3300046558 Bacteria 6624
145 Ga0495668_0002583 3300046616 Bacteria 14691
146 Ga0495668_0084394 3300046616 Bacteria 1741
147 Ga0495668_0092613 3300046616 Bacteria 1655
148 Ga0495634_0380637 3300046642 Bacteria 841
149 Ga0495611_0000320 3300046648 Bacteria 32126
150 Ga0495635_0060179 3300046663 Bacteria 2611
151 Ga0495661_0034443 3300046665 Bacteria 3186
152 Ga0495661_0071144 3300046665 Bacteria 2033
153 Ga0495646_0327563 3300046680 Bacteria 806
154 Ga0495669_0083680 3300046684 Bacteria 1467
155 Ga0495670_0147699 3300046691 Bacteria 1232
156 Ga0495649_0000094 3300046694 Bacteria 76592
157 Ga0495649_0032514 3300046694 Bacteria 2872
158 Ga0495589_0033594 3300046794 Bacteria 2575
159 Ga0495660_0029177 3300046810 Bacteria 3114
160 Ga0495604_0473101 3300047317 Bacteria 816
161 Ga0495672_0000140 3300047320 Bacteria 106637
162 Ga0495683_0000242 3300047323 Bacteria 49547
163 Ga0495683_0129300 3300047323 Bacteria 1192
164 Ga0495677_0011712 3300047445 Bacteria 3205
165 Ga0495679_013237 3300047446 Bacteria 3105
166 Ga0495681_0030644 3300047470 Bacteria 2735
167 Ga0495681_0038839 3300047470 Bacteria 2329
168 Ga0495626_0011646 3300048091 Bacteria 4642
169 Ga0495626_0038714 3300048091 Bacteria 2259
170 Ga0496102_0978526 3300048905 Bacteria 767
171 Ga0496110_0657621 3300048913 Bacteria 948
172 Ga0496111_0377857 3300048914 Unclassified 1048
173 Ga0496122_0286594 3300048925 Bacteria 897
174 Ga0496124_0284612 3300048927 Bacteria 1203
175 Ga0495678_000150 3300049459 Bacteria 84562
176 Ga0495678_000560 3300049459 Bacteria 35698
177 Ga0495682_0000399 3300049460 Bacteria 31269
178 Ga0495682_0015693 3300049460 Bacteria 2870
179 Ga0501040_0850367 3300049576 Bacteria 660
180 Ga0501073_0001054 3300049589 Bacteria 19902
181 Ga0501080_0110125 3300049742 Bacteria 2552
182 nmdc:mga05p37_205231_c1 3300050507 Bacteria 2384
183 nmdc:mga05p37_389451_c1 3300050507 Bacteria 1630
184 nmdc:mga09592_510458_c1 3300050508 Unclassified 1034
185 nmdc:mga0qj67_97529_c1 3300050509 Bacteria 2367
186 nmdc:mga06r32_564832_c1 3300050510 Unclassified 1111
187 nmdc:mga06r32_941976_c1 3300050510 Unclassified 818
188 nmdc:mga08y16_452544_c1 3300050511 Bacteria 1309
189 nmdc:mga08y16_646357_c1 3300050511 Unclassified 1062
190 nmdc:mga0rr50_108049_c1 3300050513 Bacteria 2197
191 nmdc:mga0a205_4607_c2 3300050515 Bacteria 11669
192 Ga0500635_0000041 3300053080 Bacteria 90865
193 Ga0495655_0019332 3300053083 Unclassified 1511
194 Ga0587084_032832 3300059477 Bacteria 845
195 Ga0587073_0082044 3300059492 Bacteria 802
196 Ga0587083_0002190 3300059505 Bacteria 2386
197 Ga0587088_043348 3300059508 Unclassified 855
198 Ga0587090_035245 3300059510 Bacteria 856
199 Ga0587091_040188 3300059511 Unclassified 919
200 Ga0587098_018661 3300059604 Bacteria 862
201 Ga0587106_024401 3300059605 Bacteria 925
202 Ga0587067_031788 3300059640 Bacteria 978
203 Ga0587072_033019 3300059643 Bacteria 975
204 Ga0587079_035249 3300059647 Bacteria 983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10001326 Ga0105245_100013264 107
2 3300009147 Ga0114129_10361001 Ga0114129_103610014 107
3 3300013297 Ga0157378_10046790 Ga0157378_100467902 107
4 3300014968 Ga0157379_11467830 Ga0157379_114678301 107
5 3300006846 Ga0075430_100026314 Ga0075430_1000263143 108
6 3300009101 Ga0105247_10171499 Ga0105247_101714993 108
7 3300009553 Ga0105249_11430644 Ga0105249_114306441 108
8 3300044673 Ga0453683_0413076 Ga0453683_0413076_168_497 108
9 3300050510 nmdc:mga06r32_941976_c1 nmdc:mga06r32_941976_c1_403_729 108
10 3300050513 nmdc:mga0rr50_108049_c1 nmdc:mga0rr50_108049_c1_1335_1667 110
11 3300005331 Ga0070670_100092154 Ga0070670_1000921544 111
12 3300005364 Ga0070673_100627975 Ga0070673_1006279753 111
13 3300006237 Ga0097621_100627067 Ga0097621_1006270672 111
14 3300009094 Ga0111539_10871543 Ga0111539_108715433 111
15 3300009177 Ga0105248_11802504 Ga0105248_118025042 111
16 3300014326 Ga0157380_12671466 Ga0157380_126714661 111
17 3300025925 Ga0207650_10028368 Ga0207650_100283684 111
18 3300045051 Ga0451576_1684212 Ga0451576_1684212_297_632 111
19 3300050511 nmdc:mga08y16_646357_c1 nmdc:mga08y16_646357_c1_620_970 111
20 3300005340 Ga0070689_100021795 Ga0070689_1000217953 112
21 3300005440 Ga0070705_101951518 Ga0070705_1019515181 112
22 3300005842 Ga0068858_100000390 Ga0068858_10000039023 112
23 3300006237 Ga0097621_100027924 Ga0097621_1000279246 112
24 3300009094 Ga0111539_10560153 Ga0111539_105601531 112
25 3300013297 Ga0157378_10171418 Ga0157378_101714182 112
26 3300013297 Ga0157378_10557398 Ga0157378_105573982 112
27 3300013308 Ga0157375_11340147 Ga0157375_113401472 112
28 3300025927 Ga0207687_10000974 Ga0207687_100009744 112
29 3300025936 Ga0207670_10000922 Ga0207670_1000092211 112
30 3300026035 Ga0207703_10000019 Ga0207703_10000019210 112
31 3300026088 Ga0207641_10772758 Ga0207641_107727581 112
32 3300027907 Ga0207428_10966511 Ga0207428_109665112 112
33 3300046458 Ga0495591_000439 Ga0495591_000439_28026_28364 112
34 3300046474 Ga0495605_0032515 Ga0495605_0032515_1962_2300 112
35 3300046491 Ga0495584_0000413 Ga0495584_0000413_14257_14595 112
36 3300046492 Ga0495585_0152606 Ga0495585_0152606_266_604 112
37 3300046500 Ga0495596_0010396 Ga0495596_0010396_652_990 112
38 3300046501 Ga0495607_0000558 Ga0495607_0000558_35236_35574 112
39 3300046506 Ga0495583_0000856 Ga0495583_0000856_20745_21083 112
40 3300046507 Ga0495606_0035822 Ga0495606_0035822_850_1188 112
41 3300046512 Ga0495610_0000555 Ga0495610_0000555_34459_34797 112
42 3300046513 Ga0495616_0018323 Ga0495616_0018323_2749_3087 112
43 3300046518 Ga0495631_0023270 Ga0495631_0023270_1877_2215 112
44 3300046519 Ga0495632_0013755 Ga0495632_0013755_1867_2205 112
45 3300046520 Ga0495637_0000014 Ga0495637_0000014_162755_163093 112
46 3300046522 Ga0495643_0016966 Ga0495643_0016966_1439_1777 112
47 3300046528 Ga0495642_0003173 Ga0495642_0003173_3168_3506 112
48 3300046538 Ga0495609_0204883 Ga0495609_0204883_257_595 112
49 3300046542 Ga0495597_0355200 Ga0495597_0355200_55_393 112
50 3300046558 Ga0495633_0006932 Ga0495633_0006932_3985_4323 112
51 3300046616 Ga0495668_0002583 Ga0495668_0002583_13879_14217 112
52 3300046616 Ga0495668_0084394 Ga0495668_0084394_145_483 112
53 3300046616 Ga0495668_0092613 Ga0495668_0092613_1136_1504 112
54 3300046648 Ga0495611_0000320 Ga0495611_0000320_5542_5880 112
55 3300046665 Ga0495661_0034443 Ga0495661_0034443_2263_2601 112
56 3300046665 Ga0495661_0071144 Ga0495661_0071144_479_817 112
57 3300046684 Ga0495669_0083680 Ga0495669_0083680_707_1045 112
58 3300046691 Ga0495670_0147699 Ga0495670_0147699_709_1047 112
59 3300046694 Ga0495649_0000094 Ga0495649_0000094_69020_69358 112
60 3300046694 Ga0495649_0032514 Ga0495649_0032514_1468_1806 112
61 3300046794 Ga0495589_0033594 Ga0495589_0033594_2101_2439 112
62 3300046810 Ga0495660_0029177 Ga0495660_0029177_2366_2704 112
63 3300047320 Ga0495672_0000140 Ga0495672_0000140_26434_26772 112
64 3300047323 Ga0495683_0000242 Ga0495683_0000242_34416_34754 112
65 3300047323 Ga0495683_0129300 Ga0495683_0129300_454_792 112
66 3300047445 Ga0495677_0011712 Ga0495677_0011712_1051_1389 112
67 3300047446 Ga0495679_013237 Ga0495679_013237_811_1149 112
68 3300047470 Ga0495681_0030644 Ga0495681_0030644_1236_1574 112
69 3300047470 Ga0495681_0038839 Ga0495681_0038839_1941_2279 112
70 3300048091 Ga0495626_0011646 Ga0495626_0011646_2173_2511 112
71 3300048091 Ga0495626_0038714 Ga0495626_0038714_112_450 112
72 3300049459 Ga0495678_000150 Ga0495678_000150_63908_64246 112
73 3300049459 Ga0495678_000560 Ga0495678_000560_25452_25790 112
74 3300049460 Ga0495682_0000399 Ga0495682_0000399_24089_24427 112
75 3300049460 Ga0495682_0015693 Ga0495682_0015693_657_995 112
76 3300050507 nmdc:mga05p37_389451_c1 nmdc:mga05p37_389451_c1_1134_1472 112
77 3300050511 nmdc:mga08y16_452544_c1 nmdc:mga08y16_452544_c1_88_426 112
78 3300005289 Ga0065704_10828053 Ga0065704_108280532 113
79 3300005295 Ga0065707_10147032 Ga0065707_101470324 113
80 3300005328 Ga0070676_10042964 Ga0070676_100429643 113
81 3300005334 Ga0068869_100654470 Ga0068869_1006544702 113
82 3300005337 Ga0070682_100000082 Ga0070682_10000008225 113
83 3300005339 Ga0070660_100041150 Ga0070660_1000411502 113
84 3300005339 Ga0070660_100047687 Ga0070660_1000476874 113
85 3300005347 Ga0070668_100108732 Ga0070668_1001087325 113
86 3300005353 Ga0070669_100671938 Ga0070669_1006719381 113
87 3300005365 Ga0070688_100055376 Ga0070688_1000553764 113
88 3300005366 Ga0070659_101466680 Ga0070659_1014666801 113
89 3300005444 Ga0070694_100327120 Ga0070694_1003271201 113
90 3300005457 Ga0070662_100431429 Ga0070662_1004314292 113
91 3300005459 Ga0068867_101944424 Ga0068867_1019444242 113
92 3300005466 Ga0070685_10036436 Ga0070685_100364363 113
93 3300005471 Ga0070698_100085234 Ga0070698_1000852343 113
94 3300005471 Ga0070698_100492257 Ga0070698_1004922573 113
95 3300005518 Ga0070699_100000005 Ga0070699_100000005165 113
96 3300005548 Ga0070665_100000559 Ga0070665_10000055911 113
97 3300005616 Ga0068852_100329362 Ga0068852_1003293622 113
98 3300005844 Ga0068862_100002128 Ga0068862_1000021286 113
99 3300005844 Ga0068862_100290291 Ga0068862_1002902912 113
100 3300005985 Ga0081539_10001143 Ga0081539_1000114326 113
101 3300006358 Ga0068871_100237626 Ga0068871_1002376261 113
102 3300006844 Ga0075428_100070156 Ga0075428_1000701562 113
103 3300006844 Ga0075428_100693600 Ga0075428_1006936002 113
104 3300006847 Ga0075431_100225433 Ga0075431_1002254332 113
105 3300006852 Ga0075433_10022477 Ga0075433_100224775 113
106 3300006852 Ga0075433_10880162 Ga0075433_108801622 113
107 3300006871 Ga0075434_100209889 Ga0075434_1002098892 113
108 3300006880 Ga0075429_100874849 Ga0075429_1008748492 113
109 3300006931 Ga0097620_100249959 Ga0097620_1002499592 113
110 3300007076 Ga0075435_100054006 Ga0075435_1000540065 113
111 3300009098 Ga0105245_10266005 Ga0105245_102660053 113
112 3300009147 Ga0114129_10081690 Ga0114129_100816907 113
113 3300009177 Ga0105248_10458580 Ga0105248_104585802 113
114 3300009177 Ga0105248_10865054 Ga0105248_108650542 113
115 3300009545 Ga0105237_10176962 Ga0105237_101769622 113
116 3300013307 Ga0157372_10433898 Ga0157372_104338982 113
117 3300014326 Ga0157380_10331677 Ga0157380_103316772 113
118 3300017792 Ga0163161_10085357 Ga0163161_100853574 113
119 3300025907 Ga0207645_10021139 Ga0207645_100211394 113
120 3300025909 Ga0207705_10048815 Ga0207705_100488154 113
121 3300025919 Ga0207657_10016436 Ga0207657_100164368 113
122 3300025919 Ga0207657_10074225 Ga0207657_100742251 113
123 3300025923 Ga0207681_10290142 Ga0207681_102901422 113
124 3300025932 Ga0207690_10208554 Ga0207690_102085542 113
125 3300025933 Ga0207706_10436412 Ga0207706_104364122 113
126 3300025941 Ga0207711_10627413 Ga0207711_106274132 113
127 3300025961 Ga0207712_10127954 Ga0207712_101279543 113
128 3300025961 Ga0207712_10945613 Ga0207712_109456132 113
129 3300025972 Ga0207668_10204652 Ga0207668_102046523 113
130 3300025972 Ga0207668_10216829 Ga0207668_102168294 113
131 3300028380 Ga0268265_10000564 Ga0268265_1000056421 113
132 3300028381 Ga0268264_10745429 Ga0268264_107454292 113
133 3300035085 Ga0373929_0000035 Ga0373929_0000035_14271_14612 113
134 3300037418 Ga0395900_0000505 Ga0395900_0000505_1170_1517 113
135 3300037471 Ga0395905_0242723 Ga0395905_0242723_343_684 113
136 3300041443 Ga0451789_1135778 Ga0451789_1135778_77_418 113
137 3300041452 Ga0451793_0661462 Ga0451793_0661462_135_479 113
138 3300041458 Ga0451798_0376302 Ga0451798_0376302_100_441 113
139 3300041509 Ga0451843_0687899 Ga0451843_0687899_78_419 113
140 3300042008 Ga0439450_009037 Ga0439450_009037_1322_1663 113
141 3300044684 Ga0466966_0383696 Ga0466966_0383696_253_594 113
142 3300044735 Ga0466968_0091393 Ga0466968_0091393_210_551 113
143 3300044765 Ga0466970_0422880 Ga0466970_0422880_357_698 113
144 3300045976 Ga0466967_0016003 Ga0466967_0016003_5218_5568 113
145 3300046513 Ga0495616_0129249 Ga0495616_0129249_65_406 113
146 3300048913 Ga0496110_0657621 Ga0496110_0657621_498_839 113
147 3300048914 Ga0496111_0377857 Ga0496111_0377857_527_868 113
148 3300050507 nmdc:mga05p37_205231_c1 nmdc:mga05p37_205231_c1_447_788 113
149 3300050508 nmdc:mga09592_510458_c1 nmdc:mga09592_510458_c1_38_379 113
150 3300050509 nmdc:mga0qj67_97529_c1 nmdc:mga0qj67_97529_c1_1337_1684 113
151 3300050510 nmdc:mga06r32_564832_c1 nmdc:mga06r32_564832_c1_649_990 113
152 3300050515 nmdc:mga0a205_4607_c2 nmdc:mga0a205_4607_c2_5066_5410 113
153 3300053083 Ga0495655_0019332 Ga0495655_0019332_1059_1400 113
154 3300059477 Ga0587084_032832 Ga0587084_032832_418_759 113
155 3300059492 Ga0587073_0082044 Ga0587073_0082044_37_378 113
156 3300059505 Ga0587083_0002190 Ga0587083_0002190_525_866 113
157 3300059508 Ga0587088_043348 Ga0587088_043348_96_437 113
158 3300059510 Ga0587090_035245 Ga0587090_035245_426_767 113
159 3300059511 Ga0587091_040188 Ga0587091_040188_160_501 113
160 3300059604 Ga0587098_018661 Ga0587098_018661_96_437 113
161 3300059605 Ga0587106_024401 Ga0587106_024401_161_502 113
162 3300059640 Ga0587067_031788 Ga0587067_031788_81_422 113
163 3300059643 Ga0587072_033019 Ga0587072_033019_149_490 113
164 3300059647 Ga0587079_035249 Ga0587079_035249_132_473 113
165 3300048905 Ga0496102_0978526 Ga0496102_0978526_406_750 114
166 3300049576 Ga0501040_0850367 Ga0501040_0850367_117_461 114
167 3300053080 Ga0500635_0000041 Ga0500635_0000041_9199_9543 114
168 3300005840 Ga0068870_11071739 Ga0068870_110717391 115
169 3300007076 Ga0075435_100050349 Ga0075435_1000503491 115
170 3300049742 Ga0501080_0110125 Ga0501080_0110125_1668_2015 115
171 3300005365 Ga0070688_100158377 Ga0070688_1001583773 116
172 3300005466 Ga0070685_10466870 Ga0070685_104668702 116
173 3300025915 Ga0207693_10399346 Ga0207693_103993462 116
174 3300026121 Ga0207683_10041255 Ga0207683_100412553 116
175 3300028800 Ga0265338_10042822 Ga0265338_100428222 117
176 3300033547 Ga0316212_1001907 Ga0316212_10019071 117
177 3300046454 Ga0495592_0254935 Ga0495592_0254935_325_678 117
178 3300046514 Ga0495618_0262759 Ga0495618_0262759_426_779 117
179 3300046642 Ga0495634_0380637 Ga0495634_0380637_241_594 117
180 3300046663 Ga0495635_0060179 Ga0495635_0060179_1065_1418 117
181 3300046680 Ga0495646_0327563 Ga0495646_0327563_174_527 117
182 3300047317 Ga0495604_0473101 Ga0495604_0473101_210_563 117
183 3300005440 Ga0070705_100149347 Ga0070705_1001493473 118
184 3300005564 Ga0070664_100480133 Ga0070664_1004801331 118
185 3300005615 Ga0070702_100104718 Ga0070702_1001047182 118
186 3300005843 Ga0068860_100098389 Ga0068860_1000983892 118
187 3300003322 rootL2_10239055 rootL2_102390553 119
188 3300005616 Ga0068852_100906501 Ga0068852_1009065011 119
189 3300009093 Ga0105240_10196482 Ga0105240_101964822 119
190 3300009098 Ga0105245_10797375 Ga0105245_107973752 119
191 3300009174 Ga0105241_10394466 Ga0105241_103944662 119
192 3300009177 Ga0105248_10119335 Ga0105248_101193354 119
193 3300009545 Ga0105237_10871549 Ga0105237_108715492 119
194 3300009551 Ga0105238_10663573 Ga0105238_106635732 119
195 3300013104 Ga0157370_10630325 Ga0157370_106303252 119
196 3300013297 Ga0157378_10543788 Ga0157378_105437882 119
197 3300025911 Ga0207654_10626112 Ga0207654_106261122 119
198 3300025911 Ga0207654_11308792 Ga0207654_113087922 119
199 3300025913 Ga0207695_10018095 Ga0207695_100180952 119
200 3300025927 Ga0207687_10579608 Ga0207687_105796082 119
201 3300025941 Ga0207711_10039963 Ga0207711_100399632 119
202 3300048925 Ga0496122_0286594 Ga0496122_0286594_55_420 119
203 3300048927 Ga0496124_0284612 Ga0496124_0284612_606_971 119
204 3300049589 Ga0501073_0001054 Ga0501073_0001054_2171_2548 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

32

125

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.9215 8 110
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9079 10 106
3o3w-assembly2.cif.gz_F crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9059 10 110
3gk5-assembly1.cif.gz_A crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a 0.8961 10 110
3icr-assembly1.cif.gz_A crystal structure of oxidized bacillus anthracis coadr-rhd 0.8926 8 102
ID Description Score Start End Superfamily
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9192 9 110 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9018 9 110 3.40.250.10
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8961 10 110 3.40.250.10
af_O08446_114_219_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8916 10 111 3.40.250.10
1yt8A04 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8912 10 111 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A2S8H204-F1-model_v4 deleted 1.005 1 111
AF-A0A7T9D6E3-F1-model_v4 deleted 0.9946 8 110
AF-A0A6M4H1X5-F1-model_v4 Rhodanese domain-containing protein 0.9939 1 113
AF-A0A4R8DND7-F1-model_v4 Rhodanese-related sulfurtransferase 0.9865 3 111 GO:0016740
AF-A0A6M4H1X5-F1-model_v4 Rhodanese domain-containing protein 0.9852 1 113

Feature Viewer

pLDDT pTM Quality
91.5 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map