F312372

General Info

Members Datasets Scaffolds Average Seq Length
204 122 408 197

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101168441|Ga0075428_1011684411
Length 226
Sequence MECWSSGVMEYWSDATVSNTPILQNSITPLRFMSDILNKTIVLVLNRNWQAIHVRTPQEAFCMMATNVATALEIDGEDHIRPVTWDEWITLPVRPQDNAVHTVRGPIRVPTVIVAVNFAKVPKKRPKLCAKTIRERDDNRCQYTGKALKPDEGSLDHVVPRSRGGKDAWENLVWSSKAVNTRKGNRLPEEAGLKLLSIPRAPKELPVSALIRNAPGIVDWRLFVKE

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 27.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101168441 3300006844 Unclassified 812
2 Ga0065715_10280985 3300005293 Bacteria 1086
3 Ga0070658_10547734 3300005327 Bacteria 1001
4 Ga0070690_100071462 3300005330 Bacteria 2255
5 Ga0070689_100281905 3300005340 Bacteria 1379
6 Ga0070689_100578412 3300005340 Unclassified 971
7 Ga0070688_100022870 3300005365 Bacteria 3670
8 Ga0070688_100123699 3300005365 Bacteria 1736
9 Ga0070703_10116626 3300005406 Unclassified 963
10 Ga0070705_100108530 3300005440 Bacteria 1768
11 Ga0070705_100117621 3300005440 Bacteria 1710
12 Ga0070705_100450423 3300005440 Unclassified 965
13 Ga0070694_100340341 3300005444 Bacteria 1159
14 Ga0070708_100330735 3300005445 Bacteria 1436
15 Ga0070708_100399269 3300005445 Bacteria 1296
16 Ga0070681_10098567 3300005458 Bacteria 2869
17 Ga0068867_100692803 3300005459 Bacteria 898
18 Ga0070706_100895801 3300005467 Unclassified 820
19 Ga0070698_100201211 3300005471 Unclassified 1927
20 Ga0070679_100663330 3300005530 Unclassified 986
21 Ga0070697_100768461 3300005536 Unclassified 852
22 Ga0070686_100129566 3300005544 Bacteria 1743
23 Ga0070704_100848709 3300005549 Unclassified 819
24 Ga0068855_100073612 3300005563 Bacteria 3968
25 Ga0068859_100448302 3300005617 Bacteria 1387
26 Ga0068864_100048114 3300005618 Bacteria 3665
27 Ga0068864_100285382 3300005618 Unclassified 1542
28 Ga0068863_100447978 3300005841 Bacteria 1267
29 Ga0068863_100574313 3300005841 Unclassified 1114
30 Ga0068863_100781437 3300005841 Unclassified 952
31 Ga0081455_10113021 3300005937 Unclassified 2154
32 Ga0068871_100483838 3300006358 Bacteria 1114
33 Ga0075431_100984255 3300006847 Bacteria 811
34 Ga0097620_100448304 3300006931 Bacteria 1387
35 Ga0105240_10280633 3300009093 Bacteria 1913
36 Ga0111539_10774502 3300009094 Unclassified 1117
37 Ga0114129_11629438 3300009147 Unclassified 789
38 Ga0105241_10883352 3300009174 Bacteria 829
39 Ga0105241_10953747 3300009174 Unclassified 800
40 Ga0105242_10140139 3300009176 Bacteria 2098
41 Ga0105242_10244520 3300009176 Bacteria 1614
42 Ga0105242_10494556 3300009176 Unclassified 1162
43 Ga0105248_10433203 3300009177 Bacteria 1481
44 Ga0105238_10418659 3300009551 Unclassified 1334
45 Ga0105249_11490021 3300009553 Bacteria 749
46 Ga0105246_10907803 3300011119 Unclassified 790
47 Ga0163162_11945258 3300013306 Unclassified 673
48 Ga0157375_10001255 3300013308 Bacteria 21960
49 Ga0163163_10081904 3300014325 Bacteria 3230
50 Ga0163163_10103674 3300014325 Bacteria 2869
51 Ga0157376_11453032 3300014969 Bacteria 718
52 Ga0207695_10334955 3300025913 Bacteria 1401
53 Ga0207693_10482113 3300025915 Bacteria 968
54 Ga0207652_10605340 3300025921 Unclassified 982
55 Ga0207694_10391820 3300025924 Bacteria 1154
56 Ga0207670_10008336 3300025936 Bacteria 5844
57 Ga0207670_10246367 3300025936 Bacteria 1379
58 Ga0207670_10272387 3300025936 Bacteria 1316
59 Ga0207711_10316752 3300025941 Bacteria 1441
60 Ga0207661_10723704 3300025944 Bacteria 916
61 Ga0207667_10051121 3300025949 Bacteria 4358
62 Ga0207639_10128182 3300026041 Bacteria 2096
63 Ga0207702_10209847 3300026078 Bacteria 1810
64 Ga0207641_10406647 3300026088 Bacteria 1308
65 Ga0207641_10429492 3300026088 Bacteria 1273
66 Ga0207641_10950178 3300026088 Unclassified 855
67 Ga0207641_11160492 3300026088 Bacteria 772
68 Ga0207676_10364957 3300026095 Bacteria 1339
69 Ga0207683_10520298 3300026121 Bacteria 1099
70 Ga0265337_1000449 3300028556 Bacteria 21917
71 Ga0265337_1000812 3300028556 Bacteria 16458
72 Ga0265337_1014300 3300028556 Unclassified 2634
73 Ga0265337_1065041 3300028556 Bacteria 1006
74 Ga0265326_10110331 3300028558 Unclassified 781
75 Ga0265319_1019988 3300028563 Bacteria 2490
76 Ga0265334_10044080 3300028573 Bacteria 1734
77 Ga0265323_10000456 3300028653 Bacteria 23206
78 Ga0265322_10023974 3300028654 Unclassified 1744
79 Ga0265322_10041724 3300028654 Bacteria 1306
80 Ga0265336_10008822 3300028666 Bacteria 3515
81 Ga0265336_10038011 3300028666 Unclassified 1478
82 Ga0265336_10068598 3300028666 Bacteria 1060
83 Ga0265338_10000950 3300028800 Bacteria 48759
84 Ga0265338_10001874 3300028800 Bacteria 32954
85 Ga0265338_10004648 3300028800 Bacteria 18444
86 Ga0265338_10005699 3300028800 Bacteria 16112
87 Ga0265338_10051941 3300028800 Bacteria 3685
88 Ga0265338_10071717 3300028800 Unclassified 2961
89 Ga0265338_10251704 3300028800 Bacteria 1303
90 Ga0265324_10000488 3300029957 Bacteria 27664
91 Ga0265324_10013680 3300029957 Bacteria 3021
92 Ga0265324_10051604 3300029957 Unclassified 1413
93 Ga0265324_10080326 3300029957 Unclassified 1110
94 Ga0265332_10004510 3300031238 Bacteria 6527
95 Ga0265332_10159311 3300031238 Unclassified 943
96 Ga0265328_10004082 3300031239 Bacteria 6385
97 Ga0265328_10010936 3300031239 Bacteria 3640
98 Ga0265320_10003677 3300031240 Bacteria 10242
99 Ga0265320_10003858 3300031240 Bacteria 9929
100 Ga0265329_10001022 3300031242 Bacteria 13952
101 Ga0265339_10030031 3300031249 Unclassified 3080
102 Ga0265339_10103524 3300031249 Bacteria 1479
103 Ga0265316_10059428 3300031344 Unclassified 2973
104 Ga0265314_10001361 3300031711 Bacteria 27616
105 Ga0265314_10058575 3300031711 Bacteria 2639
106 Ga0265342_10106787 3300031712 Unclassified 1588
107 Ga0265342_10119697 3300031712 Bacteria 1484
108 Ga0265342_10258627 3300031712 Unclassified 927
109 Ga0373923_0105491 3300035111 Unclassified 1247
110 Ga0373936_0125033 3300035113 Unclassified 1102
111 Ga0373954_0018138 3300035118 Bacteria 3166
112 Ga0373943_0595045 3300035170 Unclassified 651
113 Ga0373955_0131564 3300035172 Bacteria 1461
114 Ga0373924_0040469 3300035410 Bacteria 1908
115 Ga0373935_0174988 3300035692 Unclassified 1470
116 Ga0373935_0433188 3300035692 Bacteria 948
117 Ga0373935_0548865 3300035692 Unclassified 842
118 Ga0373927_0012073 3300035695 Bacteria 5745
119 Ga0373927_0018788 3300035695 Bacteria 4535
120 Ga0373947_0056061 3300035725 Bacteria 2381
121 Ga0373947_0149097 3300035725 Bacteria 1505
122 Ga0373937_0749889 3300036401 Bacteria 924
123 Ga0373925_0013560 3300037068 Bacteria 5900
124 Ga0395905_0212706 3300037471 Bacteria 1811
125 Ga0451577_0031271 3300042876 Bacteria 4804
126 Ga0451577_0161711 3300042876 Bacteria 2016
127 Ga0451577_0177294 3300042876 Bacteria 1921
128 Ga0451577_0373329 3300042876 Unclassified 1294
129 Ga0451577_0439038 3300042876 Bacteria 1185
130 Ga0453684_0017561 3300044712 Bacteria 11069
131 Ga0453684_0043850 3300044712 Bacteria 6002
132 Ga0453684_0194834 3300044712 Bacteria 2367
133 Ga0453684_0272405 3300044712 Unclassified 1934
134 Ga0453684_0823815 3300044712 Unclassified 999
135 Ga0451576_0190830 3300045051 Bacteria 2140
136 Ga0451576_0340591 3300045051 Bacteria 1570
137 Ga0451576_0425459 3300045051 Bacteria 1393
138 Ga0451576_0485905 3300045051 Bacteria 1297
139 Ga0451576_0532926 3300045051 Bacteria 1234
140 Ga0451576_0588853 3300045051 Bacteria 1169
141 Ga0451576_0840344 3300045051 Unclassified 964
142 Ga0495592_0000053 3300046454 Bacteria 108449
143 Ga0495592_0181080 3300046454 Bacteria 1435
144 Ga0495629_0606153 3300046459 Bacteria 732
145 Ga0495641_0258462 3300046461 Bacteria 783
146 Ga0495580_0306126 3300046472 Bacteria 1082
147 Ga0495582_0353138 3300046473 Unclassified 847
148 Ga0495582_0474838 3300046473 Bacteria 723
149 Ga0495639_0444269 3300046475 Bacteria 658
150 Ga0495662_0054200 3300046476 Unclassified 1937
151 Ga0495662_0298530 3300046476 Bacteria 793
152 Ga0495664_0019726 3300046477 Unclassified 3881
153 Ga0495664_0063499 3300046477 Bacteria 2201
154 Ga0495608_0334372 3300046511 Bacteria 934
155 Ga0495618_0032810 3300046514 Unclassified 3253
156 Ga0495628_0000091 3300046516 Bacteria 71204
157 Ga0495628_0075949 3300046516 Bacteria 2616
158 Ga0495630_0000039 3300046517 Bacteria 108982
159 Ga0495630_0002016 3300046517 Bacteria 14119
160 Ga0495630_0250785 3300046517 Bacteria 1352
161 Ga0495630_0676278 3300046517 Unclassified 790
162 Ga0495666_0024014 3300046526 Unclassified 3015
163 Ga0495666_0051575 3300046526 Bacteria 1976
164 Ga0495666_0075427 3300046526 Bacteria 1599
165 Ga0495666_0169717 3300046526 Unclassified 1009
166 Ga0495652_0057520 3300046529 Unclassified 3297
167 Ga0495640_0028149 3300046533 Bacteria 4048
168 Ga0495586_0000022 3300046535 Bacteria 108323
169 Ga0495586_0000317 3300046535 Bacteria 30578
170 Ga0495586_0001147 3300046535 Bacteria 14861
171 Ga0495586_0266724 3300046535 Bacteria 978
172 Ga0495586_0457618 3300046535 Unclassified 736
173 Ga0495645_0004227 3300046543 Bacteria 9815
174 Ga0495622_0028342 3300046557 Bacteria 2615
175 Ga0495667_0556264 3300046559 Bacteria 716
176 Ga0495634_0079216 3300046642 Bacteria 2152
177 Ga0495634_0350622 3300046642 Bacteria 884
178 Ga0495657_0222049 3300046675 Unclassified 1145
179 Ga0495657_0539938 3300046675 Bacteria 678
180 Ga0495599_0003416 3300046678 Bacteria 9293
181 Ga0495599_0020026 3300046678 Bacteria 4167
182 Ga0495599_0020181 3300046678 Bacteria 4151
183 Ga0495647_0062883 3300046681 Bacteria 1468
184 Ga0495658_0003878 3300046683 Bacteria 7400
185 Ga0495658_0448260 3300046683 Bacteria 824
186 Ga0495669_0302358 3300046684 Bacteria 771
187 Ga0495613_0004224 3300046689 Bacteria 10759
188 Ga0495613_0317736 3300046689 Bacteria 1075
189 Ga0495624_0012283 3300046690 Bacteria 5860
190 Ga0495674_0001356 3300047319 Bacteria 23874
191 Ga0495674_0824027 3300047319 Unclassified 720
192 Ga0495676_0024039 3300047321 Bacteria 5280
193 Ga0495676_0139034 3300047321 Bacteria 1742
194 Ga0495680_0592435 3300047322 Bacteria 743
195 Ga0495675_0037700 3300047444 Bacteria 3079
196 Ga0495675_0466075 3300047444 Bacteria 729
197 Ga0495602_0654821 3300048088 Unclassified 717
198 Ga0495614_0116112 3300048089 Bacteria 1178
199 Ga0501033_0245254 3300049570 Bacteria 1270
200 Ga0501034_0297908 3300049571 Bacteria 1550
201 Ga0501034_0363206 3300049571 Bacteria 1375
202 Ga0501070_0245668 3300049586 Bacteria 1465
203 nmdc:mga06r32_255656_c1 3300050510 Bacteria 908
204 nmdc:mga0n895_1440154_c1 3300050512 Unclassified 656
205 Ga0075428_101168441
206 Ga0065715_10280985
207 Ga0070658_10547734
208 Ga0070690_100071462
209 Ga0070689_100281905
210 Ga0070689_100578412
211 Ga0070688_100022870
212 Ga0070688_100123699
213 Ga0070703_10116626
214 Ga0070705_100108530
215 Ga0070705_100117621
216 Ga0070705_100450423
217 Ga0070694_100340341
218 Ga0070708_100330735
219 Ga0070708_100399269
220 Ga0070681_10098567
221 Ga0068867_100692803
222 Ga0070706_100895801
223 Ga0070698_100201211
224 Ga0070679_100663330
225 Ga0070697_100768461
226 Ga0070686_100129566
227 Ga0070704_100848709
228 Ga0068855_100073612
229 Ga0068859_100448302
230 Ga0068864_100048114
231 Ga0068864_100285382
232 Ga0068863_100447978
233 Ga0068863_100574313
234 Ga0068863_100781437
235 Ga0081455_10113021
236 Ga0068871_100483838
237 Ga0075431_100984255
238 Ga0097620_100448304
239 Ga0105240_10280633
240 Ga0111539_10774502
241 Ga0114129_11629438
242 Ga0105241_10883352
243 Ga0105241_10953747
244 Ga0105242_10140139
245 Ga0105242_10244520
246 Ga0105242_10494556
247 Ga0105248_10433203
248 Ga0105238_10418659
249 Ga0105249_11490021
250 Ga0105246_10907803
251 Ga0163162_11945258
252 Ga0157375_10001255
253 Ga0163163_10081904
254 Ga0163163_10103674
255 Ga0157376_11453032
256 Ga0207695_10334955
257 Ga0207693_10482113
258 Ga0207652_10605340
259 Ga0207694_10391820
260 Ga0207670_10008336
261 Ga0207670_10246367
262 Ga0207670_10272387
263 Ga0207711_10316752
264 Ga0207661_10723704
265 Ga0207667_10051121
266 Ga0207639_10128182
267 Ga0207702_10209847
268 Ga0207641_10406647
269 Ga0207641_10429492
270 Ga0207641_10950178
271 Ga0207641_11160492
272 Ga0207676_10364957
273 Ga0207683_10520298
274 Ga0265337_1000449
275 Ga0265337_1000812
276 Ga0265337_1014300
277 Ga0265337_1065041
278 Ga0265326_10110331
279 Ga0265319_1019988
280 Ga0265334_10044080
281 Ga0265323_10000456
282 Ga0265322_10023974
283 Ga0265322_10041724
284 Ga0265336_10008822
285 Ga0265336_10038011
286 Ga0265336_10068598
287 Ga0265338_10000950
288 Ga0265338_10001874
289 Ga0265338_10004648
290 Ga0265338_10005699
291 Ga0265338_10051941
292 Ga0265338_10071717
293 Ga0265338_10251704
294 Ga0265324_10000488
295 Ga0265324_10013680
296 Ga0265324_10051604
297 Ga0265324_10080326
298 Ga0265332_10004510
299 Ga0265332_10159311
300 Ga0265328_10004082
301 Ga0265328_10010936
302 Ga0265320_10003677
303 Ga0265320_10003858
304 Ga0265329_10001022
305 Ga0265339_10030031
306 Ga0265339_10103524
307 Ga0265316_10059428
308 Ga0265314_10001361
309 Ga0265314_10058575
310 Ga0265342_10106787
311 Ga0265342_10119697
312 Ga0265342_10258627
313 Ga0373923_0105491
314 Ga0373936_0125033
315 Ga0373954_0018138
316 Ga0373943_0595045
317 Ga0373955_0131564
318 Ga0373924_0040469
319 Ga0373935_0174988
320 Ga0373935_0433188
321 Ga0373935_0548865
322 Ga0373927_0012073
323 Ga0373927_0018788
324 Ga0373947_0056061
325 Ga0373947_0149097
326 Ga0373937_0749889
327 Ga0373925_0013560
328 Ga0395905_0212706
329 Ga0451577_0031271
330 Ga0451577_0161711
331 Ga0451577_0177294
332 Ga0451577_0373329
333 Ga0451577_0439038
334 Ga0453684_0017561
335 Ga0453684_0043850
336 Ga0453684_0194834
337 Ga0453684_0272405
338 Ga0453684_0823815
339 Ga0451576_0190830
340 Ga0451576_0340591
341 Ga0451576_0425459
342 Ga0451576_0485905
343 Ga0451576_0532926
344 Ga0451576_0588853
345 Ga0451576_0840344
346 Ga0495592_0000053
347 Ga0495592_0181080
348 Ga0495629_0606153
349 Ga0495641_0258462
350 Ga0495580_0306126
351 Ga0495582_0353138
352 Ga0495582_0474838
353 Ga0495639_0444269
354 Ga0495662_0054200
355 Ga0495662_0298530
356 Ga0495664_0019726
357 Ga0495664_0063499
358 Ga0495608_0334372
359 Ga0495618_0032810
360 Ga0495628_0000091
361 Ga0495628_0075949
362 Ga0495630_0000039
363 Ga0495630_0002016
364 Ga0495630_0250785
365 Ga0495630_0676278
366 Ga0495666_0024014
367 Ga0495666_0051575
368 Ga0495666_0075427
369 Ga0495666_0169717
370 Ga0495652_0057520
371 Ga0495640_0028149
372 Ga0495586_0000022
373 Ga0495586_0000317
374 Ga0495586_0001147
375 Ga0495586_0266724
376 Ga0495586_0457618
377 Ga0495645_0004227
378 Ga0495622_0028342
379 Ga0495667_0556264
380 Ga0495634_0079216
381 Ga0495634_0350622
382 Ga0495657_0222049
383 Ga0495657_0539938
384 Ga0495599_0003416
385 Ga0495599_0020026
386 Ga0495599_0020181
387 Ga0495647_0062883
388 Ga0495658_0003878
389 Ga0495658_0448260
390 Ga0495669_0302358
391 Ga0495613_0004224
392 Ga0495613_0317736
393 Ga0495624_0012283
394 Ga0495674_0001356
395 Ga0495674_0824027
396 Ga0495676_0024039
397 Ga0495676_0139034
398 Ga0495680_0592435
399 Ga0495675_0037700
400 Ga0495675_0466075
401 Ga0495602_0654821
402 Ga0495614_0116112
403 Ga0501033_0245254
404 Ga0501034_0297908
405 Ga0501034_0363206
406 Ga0501070_0245668
407 nmdc:mga06r32_255656_c1
408 nmdc:mga0n895_1440154_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13395

HNH_4

HNH endonuclease

141

189

0.96

PF14279

HNH_5

HNH endonuclease

141

196

0.94

PF01844

HNH

HNH endonuclease

139

186

0.76

Map