F312350

General Info

Members Datasets Scaffolds Average Seq Length
204 157 408 393

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10005870|Ga0075366_100058706
Length 433
Sequence MNIRELLVGSFKAALYAADPIHLVSQHLPRPERFAKGKVLIVGAGKAAAAMAKAVEDFYPDEVALSGIVITRYGHSLPLRRIRVVEAGHPVPDTSGEAAAQEIFDAVQELGPDDLVIVLVSXXXSSLLSLPVDGVSMPDLKTVTRELLRCGAPIQEMNTVRKHLSRIQGGRLAAATQAQVLSLIISDVTGDDPTHIASGPTAPDATTFQDALDILHYHSVSPPLSVARYLSRGARGEVPESLKPGDPVFNRVDNRVIATAHASLAMAAAYFQQRGVTPMILGDSVTGESAEVAKVYAALARQIHQYHHPMKPPVALISGGETTVTIRSTADRKTAPGRGGRCSEFLLSLAIELNAMGGTYALACDTDGIDGTEDNAGALLAPDSLERALAKGVDAKKLLARNDGFGFFHALDDLVVTGPTRTNVNDYRVILIQ

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.45
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10005870 3300006195 Bacteria 6675
2 Ga0070658_10019370 3300005327 Bacteria 5450
3 Ga0070692_10017084 3300005345 Bacteria 3463
4 Ga0070669_100005742 3300005353 Bacteria 8945
5 Ga0070675_100087369 3300005354 Bacteria 2607
6 Ga0070674_100053870 3300005356 Bacteria 2780
7 Ga0070688_100059786 3300005365 Bacteria 2405
8 Ga0070714_100054225 3300005435 Bacteria 3425
9 Ga0070714_100117934 3300005435 Bacteria 2358
10 Ga0070701_10058139 3300005438 Bacteria 2028
11 Ga0070700_100009867 3300005441 Bacteria 5252
12 Ga0070694_100008051 3300005444 Bacteria 6438
13 Ga0070681_10001273 3300005458 Bacteria 21994
14 Ga0068867_100001349 3300005459 Bacteria 16969
15 Ga0070679_100107845 3300005530 Bacteria 2771
16 Ga0070684_100054458 3300005535 Bacteria 3486
17 Ga0070684_100234519 3300005535 Bacteria 1676
18 Ga0070697_100021851 3300005536 Bacteria 5073
19 Ga0070697_100022622 3300005536 Bacteria 4992
20 Ga0068853_100293738 3300005539 Bacteria 1500
21 Ga0070672_100036718 3300005543 Bacteria 3735
22 Ga0070695_100109714 3300005545 Bacteria 1870
23 Ga0070696_100007600 3300005546 Bacteria 7243
24 Ga0068855_100008416 3300005563 Bacteria 12475
25 Ga0068855_100017369 3300005563 Bacteria 8657
26 Ga0068857_100066229 3300005577 Bacteria 3214
27 Ga0068856_100102666 3300005614 Bacteria 2853
28 Ga0068852_100272773 3300005616 Bacteria 1628
29 Ga0068861_100005186 3300005719 Bacteria 8786
30 Ga0068858_100009002 3300005842 Bacteria 9549
31 Ga0068858_100086942 3300005842 Bacteria 2908
32 Ga0068860_100153033 3300005843 Bacteria 2222
33 Ga0068871_100000763 3300006358 Bacteria 21687
34 Ga0068871_100041716 3300006358 Bacteria 3681
35 Ga0075430_100006618 3300006846 Bacteria 9767
36 Ga0075431_100001591 3300006847 Bacteria 21135
37 Ga0075433_10041857 3300006852 Bacteria 3971
38 Ga0075433_10223859 3300006852 Bacteria 1671
39 Ga0075434_100082980 3300006871 Bacteria 3202
40 Ga0068865_100063929 3300006881 Bacteria 2588
41 Ga0068865_100077730 3300006881 Bacteria 2372
42 Ga0075436_100000458 3300006914 Bacteria 26344
43 Ga0075436_100015936 3300006914 Bacteria 5144
44 Ga0075436_100056376 3300006914 Bacteria 2714
45 Ga0075436_100078792 3300006914 Bacteria 2282
46 Ga0075435_100002845 3300007076 Bacteria 11584
47 Ga0105240_10003296 3300009093 Bacteria 25239
48 Ga0111539_10078055 3300009094 Bacteria 3897
49 Ga0111539_10109296 3300009094 Bacteria 3245
50 Ga0111539_10133879 3300009094 Bacteria 2902
51 Ga0105243_10000707 3300009148 Bacteria 32172
52 Ga0105242_10006123 3300009176 Bacteria 9271
53 Ga0105248_10251762 3300009177 Bacteria 1988
54 Ga0105248_10277534 3300009177 Bacteria 1887
55 Ga0105238_10016281 3300009551 Bacteria 7526
56 Ga0105249_10005722 3300009553 Bacteria 10749
57 Ga0157370_10008784 3300013104 Bacteria 10854
58 Ga0157369_10180382 3300013105 Bacteria 2222
59 Ga0163162_10158022 3300013306 Bacteria 2388
60 Ga0157372_10325593 3300013307 Bacteria 1789
61 Ga0157375_10179339 3300013308 Bacteria 2269
62 Ga0157380_10009750 3300014326 Bacteria 6892
63 Ga0157377_10014337 3300014745 Bacteria 4031
64 Ga0207642_10032185 3300025899 Bacteria 2205
65 Ga0207643_10026625 3300025908 Bacteria 3202
66 Ga0207705_10020913 3300025909 Bacteria 4669
67 Ga0207707_10054906 3300025912 Bacteria 3466
68 Ga0207695_10009540 3300025913 Bacteria 12001
69 Ga0207660_10094907 3300025917 Bacteria 2218
70 Ga0207652_10098784 3300025921 Bacteria 2575
71 Ga0207681_10000785 3300025923 Bacteria 20951
72 Ga0207694_10023263 3300025924 Bacteria 4705
73 Ga0207659_10036276 3300025926 Bacteria 3414
74 Ga0207687_10017914 3300025927 Bacteria 4674
75 Ga0207700_10014025 3300025928 Bacteria 5237
76 Ga0207664_10137171 3300025929 Bacteria 2065
77 Ga0207706_10045676 3300025933 Bacteria 3880
78 Ga0207686_10003216 3300025934 Bacteria 8786
79 Ga0207709_10003921 3300025935 Bacteria 8687
80 Ga0207669_10036599 3300025937 Bacteria 2807
81 Ga0207669_10037016 3300025937 Bacteria 2795
82 Ga0207704_10005514 3300025938 Bacteria 5834
83 Ga0207704_10026351 3300025938 Bacteria 3189
84 Ga0207691_10008957 3300025940 Bacteria 9603
85 Ga0207691_10071764 3300025940 Bacteria 3124
86 Ga0207711_10037042 3300025941 Bacteria 4141
87 Ga0207661_10012432 3300025944 Bacteria 6187
88 Ga0207667_10001903 3300025949 Bacteria 26201
89 Ga0207667_10011637 3300025949 Bacteria 10213
90 Ga0207712_10002903 3300025961 Bacteria 10948
91 Ga0207703_10055784 3300026035 Bacteria 3215
92 Ga0207708_10001890 3300026075 Bacteria 15472
93 Ga0207641_10253315 3300026088 Bacteria 1645
94 Ga0207648_10004363 3300026089 Bacteria 14547
95 Ga0207648_10220488 3300026089 Bacteria 1686
96 Ga0207674_10172730 3300026116 Bacteria 2114
97 Ga0207675_100011826 3300026118 Bacteria 8160
98 Ga0207698_10049135 3300026142 Bacteria 3208
99 Ga0209969_1001846 3300027360 Bacteria 2917
100 Ga0209967_1000778 3300027364 Bacteria 4082
101 Ga0209981_1007797 3300027378 Bacteria 1448
102 Ga0209179_1005591 3300027512 Bacteria 1978
103 Ga0209999_1001808 3300027543 Bacteria 3713
104 Ga0209971_1006325 3300027682 Bacteria 2804
105 Ga0209974_10014036 3300027876 Bacteria 2669
106 Ga0268265_10000858 3300028380 Bacteria 28507
107 Ga0316575_10018524 3300031665 Bacteria 2655
108 Ga0307416_100032023 3300032002 Bacteria 3967
109 Ga0307411_10084474 3300032005 Bacteria 2196
110 Ga0373929_0005477 3300035085 Bacteria 2285
111 Ga0373934_0066429 3300035086 Bacteria 1440
112 Ga0373954_0004595 3300035118 Bacteria 5947
113 Ga0373956_0048515 3300035119 Bacteria 1902
114 Ga0373956_0090341 3300035119 Bacteria 1413
115 Ga0373957_0048878 3300035120 Bacteria 1613
116 Ga0373960_0025433 3300035121 Bacteria 1610
117 Ga0373955_0004182 3300035172 Bacteria 6371
118 Ga0373955_0050724 3300035172 Bacteria 2258
119 Ga0373961_0015598 3300035241 Bacteria 1946
120 Ga0373924_0003937 3300035410 Bacteria 5152
121 Ga0373933_0000780 3300035724 Bacteria 19427
122 Ga0373933_0025536 3300035724 Bacteria 3388
123 Ga0373937_0029010 3300036401 Bacteria 5010
124 Ga0373937_0043350 3300036401 Bacteria 4106
125 Ga0373937_0094992 3300036401 Bacteria 2764
126 Ga0316582_0072731 3300036647 Bacteria 2229
127 Ga0373925_0019802 3300037068 Bacteria 4897
128 Ga0451577_0179954 3300042876 Bacteria 1906
129 Ga0495592_0005822 3300046454 Bacteria 9140
130 Ga0495651_0000262 3300046462 Bacteria 41024
131 Ga0495651_0108991 3300046462 Bacteria 2050
132 Ga0495608_0031486 3300046511 Bacteria 3587
133 Ga0495628_0000483 3300046516 Bacteria 36474
134 Ga0495628_0086804 3300046516 Bacteria 2426
135 Ga0495652_0006767 3300046529 Bacteria 10629
136 Ga0495587_0035023 3300046536 Bacteria 3025
137 Ga0495645_0000963 3300046543 Bacteria 19629
138 Ga0495645_0001810 3300046543 Bacteria 14529
139 Ga0495657_0048438 3300046675 Bacteria 2867
140 Ga0495599_0000999 3300046678 Bacteria 15882
141 Ga0495623_0028658 3300046679 Bacteria 3582
142 Ga0495646_0097155 3300046680 Bacteria 1693
143 Ga0495600_0107521 3300046809 Bacteria 1817
144 Ga0495675_0109436 3300047444 Bacteria 1725
145 Ga0495602_0036023 3300048088 Bacteria 4609
146 Ga0496103_0139481 3300048906 Bacteria 1550
147 Ga0496108_0059369 3300048911 Bacteria 3216
148 Ga0496109_0013203 3300048912 Bacteria 7150
149 Ga0496109_0037832 3300048912 Bacteria 4361
150 Ga0496110_0022480 3300048913 Bacteria 5355
151 Ga0501032_0011877 3300049569 Bacteria 6238
152 Ga0501033_0004608 3300049570 Bacteria 11038
153 Ga0501034_0165844 3300049571 Bacteria 2177
154 Ga0501038_0069489 3300049574 Bacteria 2991
155 Ga0501039_0033605 3300049575 Bacteria 3955
156 Ga0501039_0109451 3300049575 Bacteria 2160
157 Ga0501039_0120579 3300049575 Bacteria 2055
158 Ga0501040_0244547 3300049576 Bacteria 1279
159 Ga0501041_0018917 3300049577 Bacteria 4104
160 Ga0501043_0007071 3300049579 Bacteria 8931
161 Ga0501043_0049096 3300049579 Bacteria 3317
162 Ga0501043_0091850 3300049579 Bacteria 2387
163 Ga0501047_0005455 3300049581 Bacteria 11968
164 Ga0501069_0020542 3300049585 Bacteria 3578
165 Ga0501070_0001356 3300049586 Bacteria 21938
166 Ga0501071_0008369 3300049587 Bacteria 6835
167 Ga0501071_0080943 3300049587 Bacteria 2376
168 Ga0501072_0015941 3300049588 Bacteria 5762
169 Ga0501072_0205633 3300049588 Bacteria 1569
170 Ga0501072_0227496 3300049588 Bacteria 1486
171 Ga0501073_0000321 3300049589 Bacteria 32033
172 Ga0501074_0000097 3300049590 Bacteria 42311
173 Ga0501075_0032348 3300049591 Bacteria 3884
174 Ga0501076_0012583 3300049592 Bacteria 6329
175 Ga0501077_0024917 3300049593 Bacteria 3799
176 Ga0501077_0050960 3300049593 Bacteria 2631
177 Ga0501079_0027245 3300049741 Bacteria 4381
178 Ga0501080_0004551 3300049742 Bacteria 12361
179 Ga0501080_0030171 3300049742 Bacteria 5051
180 Ga0501083_0001657 3300049744 Bacteria 15192
181 Ga0501035_0002810 3300049822 Bacteria 16839
182 Ga0501044_0068096 3300049823 Bacteria 3626
183 Ga0501045_0038705 3300049824 Bacteria 3469
184 Ga0501045_0115718 3300049824 Bacteria 1989
185 nmdc:mga0qj67_114880_c1 3300050509 Bacteria 2174
186 nmdc:mga0qj67_190805_c1 3300050509 Bacteria 1665
187 nmdc:mga0qj67_32383_c1 3300050509 Bacteria 4076
188 nmdc:mga06r32_19733_c1 3300050510 Bacteria 6194
189 nmdc:mga06r32_2818_c1 3300050510 Bacteria 15588
190 nmdc:mga08y16_109224_c1 3300050511 Bacteria 2880
191 nmdc:mga08y16_176588_c1 3300050511 Bacteria 2218
192 nmdc:mga08y16_393317_c1 3300050511 Unclassified 1420
193 nmdc:mga0n895_89285_c1 3300050512 Bacteria 3083
194 nmdc:mga0rr50_278292_c1 3300050513 Bacteria 1396
195 nmdc:mga08x19_4594_c1 3300050514 Bacteria 8198
196 nmdc:mga08x19_46810_c1 3300050514 Bacteria 2767
197 nmdc:mga0a205_37276_c1 3300050515 Bacteria 4675
198 nmdc:mga0a205_389227_c1 3300050515 Bacteria 1259
199 Ga0495601_0007255 3300053077 Bacteria 6502
200 Ga0495601_0177360 3300053077 Bacteria 1393
201 Ga0501084_0081827 3300054114 Bacteria 2709
202 Ga0501084_0100282 3300054114 Bacteria 2431
203 Ga0501082_0038427 3300060353 Bacteria 4130
204 Ga0530510_0007252 3300061734 Bacteria 7712
205 Ga0075366_10005870
206 Ga0070658_10019370
207 Ga0070692_10017084
208 Ga0070669_100005742
209 Ga0070675_100087369
210 Ga0070674_100053870
211 Ga0070688_100059786
212 Ga0070714_100054225
213 Ga0070714_100117934
214 Ga0070701_10058139
215 Ga0070700_100009867
216 Ga0070694_100008051
217 Ga0070681_10001273
218 Ga0068867_100001349
219 Ga0070679_100107845
220 Ga0070684_100054458
221 Ga0070684_100234519
222 Ga0070697_100021851
223 Ga0070697_100022622
224 Ga0068853_100293738
225 Ga0070672_100036718
226 Ga0070695_100109714
227 Ga0070696_100007600
228 Ga0068855_100008416
229 Ga0068855_100017369
230 Ga0068857_100066229
231 Ga0068856_100102666
232 Ga0068852_100272773
233 Ga0068861_100005186
234 Ga0068858_100009002
235 Ga0068858_100086942
236 Ga0068860_100153033
237 Ga0068871_100000763
238 Ga0068871_100041716
239 Ga0075430_100006618
240 Ga0075431_100001591
241 Ga0075433_10041857
242 Ga0075433_10223859
243 Ga0075434_100082980
244 Ga0068865_100063929
245 Ga0068865_100077730
246 Ga0075436_100000458
247 Ga0075436_100015936
248 Ga0075436_100056376
249 Ga0075436_100078792
250 Ga0075435_100002845
251 Ga0105240_10003296
252 Ga0111539_10078055
253 Ga0111539_10109296
254 Ga0111539_10133879
255 Ga0105243_10000707
256 Ga0105242_10006123
257 Ga0105248_10251762
258 Ga0105248_10277534
259 Ga0105238_10016281
260 Ga0105249_10005722
261 Ga0157370_10008784
262 Ga0157369_10180382
263 Ga0163162_10158022
264 Ga0157372_10325593
265 Ga0157375_10179339
266 Ga0157380_10009750
267 Ga0157377_10014337
268 Ga0207642_10032185
269 Ga0207643_10026625
270 Ga0207705_10020913
271 Ga0207707_10054906
272 Ga0207695_10009540
273 Ga0207660_10094907
274 Ga0207652_10098784
275 Ga0207681_10000785
276 Ga0207694_10023263
277 Ga0207659_10036276
278 Ga0207687_10017914
279 Ga0207700_10014025
280 Ga0207664_10137171
281 Ga0207706_10045676
282 Ga0207686_10003216
283 Ga0207709_10003921
284 Ga0207669_10036599
285 Ga0207669_10037016
286 Ga0207704_10005514
287 Ga0207704_10026351
288 Ga0207691_10008957
289 Ga0207691_10071764
290 Ga0207711_10037042
291 Ga0207661_10012432
292 Ga0207667_10001903
293 Ga0207667_10011637
294 Ga0207712_10002903
295 Ga0207703_10055784
296 Ga0207708_10001890
297 Ga0207641_10253315
298 Ga0207648_10004363
299 Ga0207648_10220488
300 Ga0207674_10172730
301 Ga0207675_100011826
302 Ga0207698_10049135
303 Ga0209969_1001846
304 Ga0209967_1000778
305 Ga0209981_1007797
306 Ga0209179_1005591
307 Ga0209999_1001808
308 Ga0209971_1006325
309 Ga0209974_10014036
310 Ga0268265_10000858
311 Ga0316575_10018524
312 Ga0307416_100032023
313 Ga0307411_10084474
314 Ga0373929_0005477
315 Ga0373934_0066429
316 Ga0373954_0004595
317 Ga0373956_0048515
318 Ga0373956_0090341
319 Ga0373957_0048878
320 Ga0373960_0025433
321 Ga0373955_0004182
322 Ga0373955_0050724
323 Ga0373961_0015598
324 Ga0373924_0003937
325 Ga0373933_0000780
326 Ga0373933_0025536
327 Ga0373937_0029010
328 Ga0373937_0043350
329 Ga0373937_0094992
330 Ga0316582_0072731
331 Ga0373925_0019802
332 Ga0451577_0179954
333 Ga0495592_0005822
334 Ga0495651_0000262
335 Ga0495651_0108991
336 Ga0495608_0031486
337 Ga0495628_0000483
338 Ga0495628_0086804
339 Ga0495652_0006767
340 Ga0495587_0035023
341 Ga0495645_0000963
342 Ga0495645_0001810
343 Ga0495657_0048438
344 Ga0495599_0000999
345 Ga0495623_0028658
346 Ga0495646_0097155
347 Ga0495600_0107521
348 Ga0495675_0109436
349 Ga0495602_0036023
350 Ga0496103_0139481
351 Ga0496108_0059369
352 Ga0496109_0013203
353 Ga0496109_0037832
354 Ga0496110_0022480
355 Ga0501032_0011877
356 Ga0501033_0004608
357 Ga0501034_0165844
358 Ga0501038_0069489
359 Ga0501039_0033605
360 Ga0501039_0109451
361 Ga0501039_0120579
362 Ga0501040_0244547
363 Ga0501041_0018917
364 Ga0501043_0007071
365 Ga0501043_0049096
366 Ga0501043_0091850
367 Ga0501047_0005455
368 Ga0501069_0020542
369 Ga0501070_0001356
370 Ga0501071_0008369
371 Ga0501071_0080943
372 Ga0501072_0015941
373 Ga0501072_0205633
374 Ga0501072_0227496
375 Ga0501073_0000321
376 Ga0501074_0000097
377 Ga0501075_0032348
378 Ga0501076_0012583
379 Ga0501077_0024917
380 Ga0501077_0050960
381 Ga0501079_0027245
382 Ga0501080_0004551
383 Ga0501080_0030171
384 Ga0501083_0001657
385 Ga0501035_0002810
386 Ga0501044_0068096
387 Ga0501045_0038705
388 Ga0501045_0115718
389 nmdc:mga0qj67_114880_c1
390 nmdc:mga0qj67_190805_c1
391 nmdc:mga0qj67_32383_c1
392 nmdc:mga06r32_19733_c1
393 nmdc:mga06r32_2818_c1
394 nmdc:mga08y16_109224_c1
395 nmdc:mga08y16_176588_c1
396 nmdc:mga08y16_393317_c1
397 nmdc:mga0n895_89285_c1
398 nmdc:mga0rr50_278292_c1
399 nmdc:mga08x19_4594_c1
400 nmdc:mga08x19_46810_c1
401 nmdc:mga0a205_37276_c1
402 nmdc:mga0a205_389227_c1
403 Ga0495601_0007255
404 Ga0495601_0177360
405 Ga0501084_0081827
406 Ga0501084_0100282
407 Ga0501082_0038427
408 Ga0530510_0007252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05161

MOFRL

MOFRL family

314

426

0.96

PF13660

DUF4147

Domain of unknown function (DUF4147)

6

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.8981 8 427
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.8879 8 427
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.8189 3 426
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.8121 3 426
7xlz-assembly2.cif.gz_B structure of siderophore-interacting protein from vibrio anguillarum 0.6102 36 129
ID Description Score Start End Superfamily
2b8nB01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.9449 261 427 3.40.1480.10
1x3lA01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.9095 261 426 3.40.1480.10
af_Q8QZY2_51_305_3.40.50.10180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.8902 39 254 3.40.50.10180
af_Q08BL7_290_493_3.40.1480.10 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.8898 265 426 3.40.1480.10
2b8nB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.8843 24 259 3.40.50.10180
ID Description Score Start End GO Terms
AF-A0A536TPV3-F1-model_v4 Glycerate kinase 0.9846 5 427 GO:0005737
GO:0008887
AF-A0A536TPV3-F1-model_v4 Glycerate kinase 0.9823 5 427 GO:0005737
GO:0008887
AF-A0A5C7VD08-F1-model_v4 Glycerate kinase 0.981 5 427 GO:0005737
GO:0008887
AF-A0A5C7VD08-F1-model_v4 Glycerate kinase 0.9787 5 427 GO:0005737
GO:0008887
AF-A0A7V9FUZ6-F1-model_v4 Glycerate kinase 0.977 6 427 GO:0005737
GO:0008887

Map