F312048

General Info

Members Datasets Scaffolds Average Seq Length
204 134 408 307

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10014029|Ga0065712_100140292
Length 351
Sequence MSRFTDPRSTVHPKLQNRSTSNFQPPTPKKNPEALGVGNWELGIDARVRAVVSRRGFFQVAASAFASALVPASIATAQARISTIDLGGATLFQGAGCNVIAVPGPDGALMIDGGLAANAEALLTAIKKATGATRIHTLINTHWHPEQTGANEAVGKSGGVIVAHEKTKTLVSSTVYSAIGFTDRVRPLPQAARPTKTARGDGSMEFAGQPIEYGYMPAAHTDGDLFVHFPKLNLLAVGGVVSAEEWPXLDYKNGAWLGGRVRALERLATLVKPDTRVVPANGRMMTGTDIVRHCVIYQKLFTTMIGYLNMGLGPEDAVQRNPLKEYQSEFGDPSAFTYGALRSMMIAYVPD

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.43
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 25.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10014029 3300005290 Bacteria 2627
2 JGI25406J46586_10000592 3300003203 Bacteria 17066
3 Ga0065715_10009765 3300005293 Bacteria 3187
4 Ga0065715_10107226 3300005293 Bacteria 2783
5 Ga0070658_10062971 3300005327 Unclassified 3023
6 Ga0070683_100054522 3300005329 Bacteria 3707
7 Ga0070670_100015217 3300005331 Bacteria 6603
8 Ga0070670_100033485 3300005331 Unclassified 4425
9 Ga0070677_10028321 3300005333 Bacteria 2116
10 Ga0068868_100059574 3300005338 Unclassified 3020
11 Ga0070675_100077634 3300005354 Unclassified 2765
12 Ga0070675_100108904 3300005354 Bacteria 2340
13 Ga0070675_100244742 3300005354 Bacteria 1568
14 Ga0070671_100178565 3300005355 Unclassified 1797
15 Ga0070674_100208712 3300005356 Bacteria 1512
16 Ga0070673_100215744 3300005364 Bacteria 1659
17 Ga0070688_100059627 3300005365 Unclassified 2407
18 Ga0070659_100186644 3300005366 Unclassified 1703
19 Ga0070710_10338940 3300005437 Unclassified 992
20 Ga0070663_100054184 3300005455 Bacteria 2866
21 Ga0070678_100100737 3300005456 Bacteria 2238
22 Ga0070678_100171867 3300005456 Bacteria 1766
23 Ga0070681_10003383 3300005458 Bacteria 14919
24 Ga0070681_10040655 3300005458 Bacteria 4658
25 Ga0070681_10230639 3300005458 Unclassified 1766
26 Ga0070679_100000740 3300005530 Bacteria 28228
27 Ga0070679_100033089 3300005530 Bacteria 5117
28 Ga0070684_100170848 3300005535 Bacteria 1975
29 Ga0070672_100085653 3300005543 Unclassified 2533
30 Ga0070672_100367866 3300005543 Unclassified 1228
31 Ga0068855_100001582 3300005563 Bacteria 28584
32 Ga0070664_100039085 3300005564 Bacteria 3997
33 Ga0070664_100066751 3300005564 Unclassified 3072
34 Ga0068854_100057546 3300005578 Bacteria 2805
35 Ga0068859_100114507 3300005617 Bacteria 2761
36 Ga0068859_100129234 3300005617 Unclassified 2597
37 Ga0068859_100209426 3300005617 Unclassified 2036
38 Ga0068866_10047822 3300005718 Bacteria 2159
39 Ga0068861_100060519 3300005719 Bacteria 2902
40 Ga0068870_10219140 3300005840 Bacteria 1164
41 Ga0068863_100240078 3300005841 Unclassified 1749
42 Ga0068858_100003265 3300005842 Bacteria 16167
43 Ga0068858_100008807 3300005842 Bacteria 9676
44 Ga0068860_100347489 3300005843 Unclassified 1459
45 Ga0068862_100136238 3300005844 Bacteria 2176
46 Ga0081455_10051382 3300005937 Unclassified 3536
47 Ga0081539_10000017 3300005985 Bacteria 375107
48 Ga0081539_10002038 3300005985 Bacteria 30443
49 Ga0081539_10091229 3300005985 Unclassified 1574
50 Ga0097621_100001822 3300006237 Bacteria 14616
51 Ga0097621_100006045 3300006237 Bacteria 8556
52 Ga0097621_100103031 3300006237 Bacteria 2403
53 Ga0097621_100165123 3300006237 Unclassified 1906
54 Ga0068871_100000687 3300006358 Bacteria 23018
55 Ga0068871_100002128 3300006358 Bacteria 13423
56 Ga0075428_100020944 3300006844 Bacteria 7242
57 Ga0075430_100065765 3300006846 Unclassified 3045
58 Ga0075431_100039785 3300006847 Unclassified 4844
59 Ga0075433_10000206 3300006852 Bacteria 33103
60 Ga0075433_10001154 3300006852 Bacteria 19190
61 Ga0075434_100001290 3300006871 Bacteria 20908
62 Ga0075434_100027648 3300006871 Bacteria 5570
63 Ga0075429_100188117 3300006880 Unclassified 1809
64 Ga0068865_100006731 3300006881 Bacteria 7031
65 Ga0097620_100114504 3300006931 Bacteria 2761
66 Ga0097620_100129240 3300006931 Unclassified 2597
67 Ga0097620_100209430 3300006931 Unclassified 2036
68 Ga0105240_10002696 3300009093 Bacteria 28236
69 Ga0105240_10706005 3300009093 Bacteria 1100
70 Ga0111539_10007995 3300009094 Bacteria 13491
71 Ga0111539_10033994 3300009094 Bacteria 6186
72 Ga0111539_10090143 3300009094 Bacteria 3603
73 Ga0111539_10304652 3300009094 Bacteria 1854
74 Ga0105247_10008089 3300009101 Bacteria 6423
75 Ga0114129_10042540 3300009147 Bacteria 6396
76 Ga0114129_10054641 3300009147 Bacteria 5598
77 Ga0114129_10150790 3300009147 Bacteria 3182
78 Ga0114129_10694572 3300009147 Bacteria 1308
79 Ga0105242_10130240 3300009176 Unclassified 2170
80 Ga0105248_10092183 3300009177 Unclassified 3412
81 Ga0105238_10006077 3300009551 Bacteria 11977
82 Ga0105238_10027808 3300009551 Bacteria 5763
83 Ga0157370_10002512 3300013104 Bacteria 22073
84 Ga0157370_10066770 3300013104 Bacteria 3401
85 Ga0157369_10001809 3300013105 Bacteria 25876
86 Ga0157369_10100393 3300013105 Bacteria 3085
87 Ga0157369_10355699 3300013105 Bacteria 1521
88 Ga0157374_10139019 3300013296 Unclassified 2357
89 Ga0157374_10372120 3300013296 Bacteria 1422
90 Ga0157374_10443533 3300013296 Bacteria 1299
91 Ga0157378_10015960 3300013297 Bacteria 6578
92 Ga0157378_10162586 3300013297 Unclassified 2089
93 Ga0157378_10181716 3300013297 Bacteria 1979
94 Ga0157375_10129674 3300013308 Unclassified 2640
95 Ga0163163_10023820 3300014325 Bacteria 5818
96 Ga0163163_10681679 3300014325 Bacteria 1091
97 Ga0157380_10269124 3300014326 Bacteria 1552
98 Ga0157379_10010176 3300014968 Bacteria 8194
99 Ga0157379_10019893 3300014968 Bacteria 5931
100 Ga0157376_10122968 3300014969 Unclassified 2303
101 Ga0213876_10022321 3300021384 Bacteria 3348
102 Ga0207642_10013836 3300025899 Bacteria 2957
103 Ga0207710_10099763 3300025900 Unclassified 1368
104 Ga0207645_10179833 3300025907 Bacteria 1387
105 Ga0207643_10207847 3300025908 Bacteria 1194
106 Ga0207707_10000427 3300025912 Bacteria 43763
107 Ga0207707_10002036 3300025912 Bacteria 18342
108 Ga0207707_10050512 3300025912 Unclassified 3622
109 Ga0207707_10201343 3300025912 Unclassified 1736
110 Ga0207695_10013579 3300025913 Bacteria 9701
111 Ga0207695_10046628 3300025913 Bacteria 4593
112 Ga0207660_10002349 3300025917 Bacteria 12457
113 Ga0207652_10002994 3300025921 Bacteria 14107
114 Ga0207652_10107973 3300025921 Bacteria 2466
115 Ga0207694_10003549 3300025924 Bacteria 12390
116 Ga0207650_10009884 3300025925 Bacteria 6526
117 Ga0207659_10005060 3300025926 Bacteria 7996
118 Ga0207659_10029477 3300025926 Bacteria 3741
119 Ga0207659_10044715 3300025926 Unclassified 3117
120 Ga0207687_10076017 3300025927 Bacteria 2411
121 Ga0207644_10126161 3300025931 Bacteria 1954
122 Ga0207686_10007425 3300025934 Bacteria 5901
123 Ga0207686_10071564 3300025934 Unclassified 2232
124 Ga0207669_10269486 3300025937 Bacteria 1278
125 Ga0207704_10026759 3300025938 Unclassified 3170
126 Ga0207691_10054027 3300025940 Bacteria 3665
127 Ga0207691_10186383 3300025940 Unclassified 1811
128 Ga0207691_10192337 3300025940 Unclassified 1779
129 Ga0207711_10148474 3300025941 Bacteria 2114
130 Ga0207689_10298767 3300025942 Unclassified 1334
131 Ga0207661_10143858 3300025944 Bacteria 2055
132 Ga0207679_10025392 3300025945 Bacteria 4074
133 Ga0207679_10289965 3300025945 Bacteria 1407
134 Ga0207667_10001097 3300025949 Bacteria 34320
135 Ga0207667_10071132 3300025949 Bacteria 3619
136 Ga0207651_10058605 3300025960 Bacteria 2662
137 Ga0207651_10187749 3300025960 Bacteria 1646
138 Ga0207658_10205208 3300025986 Unclassified 1648
139 Ga0207677_10008607 3300026023 Bacteria 5712
140 Ga0207703_10005597 3300026035 Bacteria 10087
141 Ga0207703_10008293 3300026035 Bacteria 8208
142 Ga0207639_10278243 3300026041 Bacteria 1471
143 Ga0207678_10029603 3300026067 Bacteria 4781
144 Ga0207708_10158403 3300026075 Bacteria 1787
145 Ga0207702_10116635 3300026078 Bacteria 2383
146 Ga0207641_10292319 3300026088 Bacteria 1536
147 Ga0207648_10047743 3300026089 Bacteria 3751
148 Ga0207676_10135276 3300026095 Bacteria 2102
149 Ga0207675_100047268 3300026118 Bacteria 4018
150 Ga0207683_10021133 3300026121 Bacteria 5570
151 Ga0207683_10023612 3300026121 Bacteria 5290
152 Ga0207683_10064710 3300026121 Unclassified 3223
153 Ga0209974_10033206 3300027876 Bacteria 1712
154 Ga0207428_10001352 3300027907 Bacteria 26145
155 Ga0207428_10005556 3300027907 Bacteria 11741
156 Ga0268265_10036401 3300028380 Bacteria 3605
157 Ga0268265_10429471 3300028380 Bacteria 1229
158 Ga0268264_10179063 3300028381 Unclassified 1924
159 Ga0373946_0131700 3300035171 Bacteria 1151
160 Ga0373937_0216998 3300036401 Unclassified 1800
161 Ga0373937_0222939 3300036401 Unclassified 1775
162 Ga0373937_0394286 3300036401 Bacteria 1313
163 Ga0436365_0190104 3300039437 Bacteria 2246
164 Ga0450908_020925 3300042184 Unclassified 1149
165 Ga0495651_0135924 3300046462 Bacteria 1789
166 Ga0495580_0151587 3300046472 Unclassified 1606
167 Ga0495628_0310119 3300046516 Bacteria 1166
168 Ga0495643_0002382 3300046522 Bacteria 15013
169 Ga0495645_0068051 3300046543 Unclassified 2571
170 Ga0495667_0030691 3300046559 Unclassified 3611
171 Ga0495656_0090819 3300046615 Bacteria 1396
172 Ga0495658_0098968 3300046683 Bacteria 1738
173 Ga0495669_0036454 3300046684 Bacteria 2174
174 Ga0495669_0095918 3300046684 Bacteria 1374
175 Ga0495613_0000218 3300046689 Bacteria 55943
176 Ga0495600_0086377 3300046809 Bacteria 2047
177 Ga0495674_0013828 3300047319 Bacteria 7576
178 Ga0495684_0000106 3300047471 Bacteria 59745
179 Ga0496100_0001360 3300048903 Bacteria 11981
180 Ga0496101_0000846 3300048904 Bacteria 18019
181 Ga0496104_0015664 3300048907 Bacteria 6876
182 Ga0496105_0142990 3300048908 Bacteria 1968
183 Ga0496106_0019612 3300048909 Bacteria 5016
184 Ga0496114_0001483 3300048917 Bacteria 17820
185 Ga0496114_0190367 3300048917 Unclassified 1795
186 nmdc:mga05p37_36968_c1 3300050507 Bacteria 5989
187 nmdc:mga05p37_67408_c1 3300050507 Unclassified 4403
188 nmdc:mga05p37_91570_c1 3300050507 Unclassified 3747
189 nmdc:mga09592_44068_c1 3300050508 Unclassified 3754
190 nmdc:mga0qj67_140578_c1 3300050509 Unclassified 1957
191 nmdc:mga0qj67_28347_c1 3300050509 Bacteria 4346
192 nmdc:mga0qj67_365321_c1 3300050509 Bacteria 1166
193 nmdc:mga06r32_75618_c1 3300050510 Bacteria 3269
194 nmdc:mga08y16_19682_c1 3300050511 Bacteria 7116
195 nmdc:mga08y16_5507_c1 3300050511 Bacteria 13244
196 nmdc:mga08y16_893_c1 3300050511 Bacteria 28802
197 nmdc:mga0n895_16986_c1 3300050512 Bacteria 6696
198 nmdc:mga0n895_26376_c1 3300050512 Bacteria 5502
199 nmdc:mga0rr50_277915_c1 3300050513 Bacteria 1397
200 nmdc:mga0a205_331_c1 3300050515 Bacteria 35353
201 nmdc:mga0a205_498_c1 3300050515 Bacteria 30776
202 Ga0495601_0002265 3300053077 Bacteria 10854
203 Ga0495619_0004340 3300053085 Bacteria 9043
204 Ga0501082_0610052 3300060353 Bacteria 955
205 Ga0065712_10014029
206 JGI25406J46586_10000592
207 Ga0065715_10009765
208 Ga0065715_10107226
209 Ga0070658_10062971
210 Ga0070683_100054522
211 Ga0070670_100015217
212 Ga0070670_100033485
213 Ga0070677_10028321
214 Ga0068868_100059574
215 Ga0070675_100077634
216 Ga0070675_100108904
217 Ga0070675_100244742
218 Ga0070671_100178565
219 Ga0070674_100208712
220 Ga0070673_100215744
221 Ga0070688_100059627
222 Ga0070659_100186644
223 Ga0070710_10338940
224 Ga0070663_100054184
225 Ga0070678_100100737
226 Ga0070678_100171867
227 Ga0070681_10003383
228 Ga0070681_10040655
229 Ga0070681_10230639
230 Ga0070679_100000740
231 Ga0070679_100033089
232 Ga0070684_100170848
233 Ga0070672_100085653
234 Ga0070672_100367866
235 Ga0068855_100001582
236 Ga0070664_100039085
237 Ga0070664_100066751
238 Ga0068854_100057546
239 Ga0068859_100114507
240 Ga0068859_100129234
241 Ga0068859_100209426
242 Ga0068866_10047822
243 Ga0068861_100060519
244 Ga0068870_10219140
245 Ga0068863_100240078
246 Ga0068858_100003265
247 Ga0068858_100008807
248 Ga0068860_100347489
249 Ga0068862_100136238
250 Ga0081455_10051382
251 Ga0081539_10000017
252 Ga0081539_10002038
253 Ga0081539_10091229
254 Ga0097621_100001822
255 Ga0097621_100006045
256 Ga0097621_100103031
257 Ga0097621_100165123
258 Ga0068871_100000687
259 Ga0068871_100002128
260 Ga0075428_100020944
261 Ga0075430_100065765
262 Ga0075431_100039785
263 Ga0075433_10000206
264 Ga0075433_10001154
265 Ga0075434_100001290
266 Ga0075434_100027648
267 Ga0075429_100188117
268 Ga0068865_100006731
269 Ga0097620_100114504
270 Ga0097620_100129240
271 Ga0097620_100209430
272 Ga0105240_10002696
273 Ga0105240_10706005
274 Ga0111539_10007995
275 Ga0111539_10033994
276 Ga0111539_10090143
277 Ga0111539_10304652
278 Ga0105247_10008089
279 Ga0114129_10042540
280 Ga0114129_10054641
281 Ga0114129_10150790
282 Ga0114129_10694572
283 Ga0105242_10130240
284 Ga0105248_10092183
285 Ga0105238_10006077
286 Ga0105238_10027808
287 Ga0157370_10002512
288 Ga0157370_10066770
289 Ga0157369_10001809
290 Ga0157369_10100393
291 Ga0157369_10355699
292 Ga0157374_10139019
293 Ga0157374_10372120
294 Ga0157374_10443533
295 Ga0157378_10015960
296 Ga0157378_10162586
297 Ga0157378_10181716
298 Ga0157375_10129674
299 Ga0163163_10023820
300 Ga0163163_10681679
301 Ga0157380_10269124
302 Ga0157379_10010176
303 Ga0157379_10019893
304 Ga0157376_10122968
305 Ga0213876_10022321
306 Ga0207642_10013836
307 Ga0207710_10099763
308 Ga0207645_10179833
309 Ga0207643_10207847
310 Ga0207707_10000427
311 Ga0207707_10002036
312 Ga0207707_10050512
313 Ga0207707_10201343
314 Ga0207695_10013579
315 Ga0207695_10046628
316 Ga0207660_10002349
317 Ga0207652_10002994
318 Ga0207652_10107973
319 Ga0207694_10003549
320 Ga0207650_10009884
321 Ga0207659_10005060
322 Ga0207659_10029477
323 Ga0207659_10044715
324 Ga0207687_10076017
325 Ga0207644_10126161
326 Ga0207686_10007425
327 Ga0207686_10071564
328 Ga0207669_10269486
329 Ga0207704_10026759
330 Ga0207691_10054027
331 Ga0207691_10186383
332 Ga0207691_10192337
333 Ga0207711_10148474
334 Ga0207689_10298767
335 Ga0207661_10143858
336 Ga0207679_10025392
337 Ga0207679_10289965
338 Ga0207667_10001097
339 Ga0207667_10071132
340 Ga0207651_10058605
341 Ga0207651_10187749
342 Ga0207658_10205208
343 Ga0207677_10008607
344 Ga0207703_10005597
345 Ga0207703_10008293
346 Ga0207639_10278243
347 Ga0207678_10029603
348 Ga0207708_10158403
349 Ga0207702_10116635
350 Ga0207641_10292319
351 Ga0207648_10047743
352 Ga0207676_10135276
353 Ga0207675_100047268
354 Ga0207683_10021133
355 Ga0207683_10023612
356 Ga0207683_10064710
357 Ga0209974_10033206
358 Ga0207428_10001352
359 Ga0207428_10005556
360 Ga0268265_10036401
361 Ga0268265_10429471
362 Ga0268264_10179063
363 Ga0373946_0131700
364 Ga0373937_0216998
365 Ga0373937_0222939
366 Ga0373937_0394286
367 Ga0436365_0190104
368 Ga0450908_020925
369 Ga0495651_0135924
370 Ga0495580_0151587
371 Ga0495628_0310119
372 Ga0495643_0002382
373 Ga0495645_0068051
374 Ga0495667_0030691
375 Ga0495656_0090819
376 Ga0495658_0098968
377 Ga0495669_0036454
378 Ga0495669_0095918
379 Ga0495613_0000218
380 Ga0495600_0086377
381 Ga0495674_0013828
382 Ga0495684_0000106
383 Ga0496100_0001360
384 Ga0496101_0000846
385 Ga0496104_0015664
386 Ga0496105_0142990
387 Ga0496106_0019612
388 Ga0496114_0001483
389 Ga0496114_0190367
390 nmdc:mga05p37_36968_c1
391 nmdc:mga05p37_67408_c1
392 nmdc:mga05p37_91570_c1
393 nmdc:mga09592_44068_c1
394 nmdc:mga0qj67_140578_c1
395 nmdc:mga0qj67_28347_c1
396 nmdc:mga0qj67_365321_c1
397 nmdc:mga06r32_75618_c1
398 nmdc:mga08y16_19682_c1
399 nmdc:mga08y16_5507_c1
400 nmdc:mga08y16_893_c1
401 nmdc:mga0n895_16986_c1
402 nmdc:mga0n895_26376_c1
403 nmdc:mga0rr50_277915_c1
404 nmdc:mga0a205_331_c1
405 nmdc:mga0a205_498_c1
406 Ga0495601_0002265
407 Ga0495619_0004340
408 Ga0501082_0610052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

93

282

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyx-assembly1.cif.gz_A metallo-beta-lactamase (1bc2) single point mutant d120s 0.81 52 279
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8098 51 279
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.8045 51 262
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8027 51 279
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.7968 51 276
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.889 180 266 3.60.15.10
af_Q682P6_229_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8144 92 267 3.60.15.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7944 180 266 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7908 68 279 3.60.15.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7749 51 267 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1Q7Y897-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9533 51 327 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A7V8NP52-F1-model_v4 Uncharacterized protein 0.9451 230 333
AF-A0A1Q7Y897-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.943 51 327 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A1Z8N273-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9378 184 327
AF-A0A2W4MJU4-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9297 50 333 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872

Map