F312012

General Info

Members Datasets Scaffolds Average Seq Length
204 152 408 523

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10165033|rootL2_101650334
Length 559
Sequence MSTLLIPFVLAAPAAMPEKMNPAALAMFLGFVAITLVVTYFSARKSRGSSAYFAAGRRITGWQNGLAISGDYMSAASFLGIAGMIAFKGYDGFMYSVGFLVAYLTVLLIVAEPLRNAGKYTMADLLAYRLNQRPVRAAGSLSTLTVSTFYMIAQMVGAGGLVKLLLPGISYEWAVTGVGILMIVYVVFGGMLATTWVQIIKAVLLLSGTLLLSILVLAHFGFSFGKFFDAIAHVPVVDPKTKETVIKNFLDPGLAYGRTATNPWGPLDLFSLGLALVFGTAGLPHVLVRFYTVPDAKTARSSVVWAMLLIGGFYILTTFLGFGAATILTPAHILVGGKPNDNMAAPLLAQALGGEIFFAFISAVAFATILAVVAGLTISASTSFAHDFYTNVIHHGKEHRAGEEVKVARITAFVVGAISIFLAIKLQTINVAFLVGLAFAVAASANLPAIVLSIFWKRFNTAGAVTGLIVGLVSSIALIIISPSIMGVDPAGTAQNLQHLIQHPAIFPLKNPGIVSIPLGFFAAVLATLLTREPSAEAKFSELLVRGNTGLGAEKATTH

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
148 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.49
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 1.96
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10165033 3300003322 Bacteria 4284
2 CNXas_1000029 3300000545 Bacteria 29687
3 JGI24743J22301_10000934 3300001991 Bacteria 3765
4 rootL2_10043555 3300003322 Bacteria 3541
5 Ga0070676_10012869 3300005328 Bacteria 4580
6 Ga0070670_100009169 3300005331 Bacteria 8459
7 Ga0070670_100022529 3300005331 Bacteria 5420
8 Ga0070666_10044545 3300005335 Bacteria 2972
9 Ga0070661_100000482 3300005344 Bacteria 30455
10 Ga0070668_100014734 3300005347 Bacteria 5843
11 Ga0070668_100075796 3300005347 Bacteria 2626
12 Ga0070668_100104834 3300005347 Bacteria 2245
13 Ga0070669_100018892 3300005353 Bacteria 4926
14 Ga0070669_100031789 3300005353 Bacteria 3812
15 Ga0070675_100020973 3300005354 Bacteria 5218
16 Ga0070675_100097341 3300005354 Bacteria 2474
17 Ga0070671_100109305 3300005355 Bacteria 2322
18 Ga0070674_100067027 3300005356 Bacteria 2524
19 Ga0070673_100036548 3300005364 Bacteria 3734
20 Ga0070673_100076851 3300005364 Bacteria 2697
21 Ga0070659_100005785 3300005366 Bacteria 8903
22 Ga0070667_100068840 3300005367 Bacteria 3012
23 Ga0070709_10000171 3300005434 Bacteria 40897
24 Ga0070714_100000074 3300005435 Bacteria 86593
25 Ga0070714_100014060 3300005435 Bacteria 6423
26 Ga0070714_100102430 3300005435 Bacteria 2524
27 Ga0070713_100000029 3300005436 Bacteria 90705
28 Ga0070713_100013098 3300005436 Bacteria 6112
29 Ga0070713_100033301 3300005436 Bacteria 4126
30 Ga0070710_10012585 3300005437 Bacteria 4207
31 Ga0070710_10013395 3300005437 Bacteria 4107
32 Ga0070711_100028501 3300005439 Bacteria 3675
33 Ga0070711_100028563 3300005439 Bacteria 3672
34 Ga0070711_100119862 3300005439 Bacteria 1944
35 Ga0070708_100001145 3300005445 Bacteria 20356
36 Ga0070678_100016182 3300005456 Bacteria 4763
37 Ga0070681_10004186 3300005458 Bacteria 13663
38 Ga0070706_100001703 3300005467 Bacteria 22887
39 Ga0070699_100045296 3300005518 Bacteria 3807
40 Ga0070699_100097437 3300005518 Bacteria 2576
41 Ga0070679_100000869 3300005530 Bacteria 26248
42 Ga0070684_100019265 3300005535 Bacteria 5642
43 Ga0070697_100000148 3300005536 Bacteria 57034
44 Ga0070697_100067471 3300005536 Bacteria 2926
45 Ga0070665_100019285 3300005548 Bacteria 6843
46 Ga0068855_100019246 3300005563 Bacteria 8206
47 Ga0070664_100159611 3300005564 Bacteria 1994
48 Ga0068857_100005305 3300005577 Bacteria 10974
49 Ga0068854_100020935 3300005578 Bacteria 4432
50 Ga0068856_100006941 3300005614 Bacteria 11074
51 Ga0068864_100014442 3300005618 Bacteria 6559
52 Ga0068851_10007666 3300005834 Bacteria 4965
53 Ga0068863_100016967 3300005841 Bacteria 6983
54 Ga0068858_100031646 3300005842 Bacteria 4915
55 Ga0068858_100036448 3300005842 Bacteria 4561
56 Ga0068858_100061385 3300005842 Bacteria 3475
57 Ga0068860_100000459 3300005843 Bacteria 51043
58 Ga0068862_100148934 3300005844 Bacteria 2082
59 Ga0081455_10007864 3300005937 Bacteria 11162
60 Ga0081538_10018892 3300005981 Bacteria 5152
61 Ga0081539_10001175 3300005985 Bacteria 47406
62 Ga0070716_100033605 3300006173 Bacteria 2807
63 Ga0070712_100000666 3300006175 Bacteria 20296
64 Ga0070712_100006642 3300006175 Bacteria 7192
65 Ga0070712_100049004 3300006175 Bacteria 2931
66 Ga0097621_100003487 3300006237 Bacteria 10847
67 Ga0097621_100120586 3300006237 Bacteria 2224
68 Ga0097621_100173675 3300006237 Bacteria 1859
69 Ga0068871_100000507 3300006358 Bacteria 26656
70 Ga0075431_100014498 3300006847 Bacteria 7974
71 Ga0075431_100060257 3300006847 Bacteria 3916
72 Ga0075435_100089349 3300007076 Unclassified 2540
73 Ga0099794_10000233 3300007265 Bacteria 19966
74 Ga0105240_10000022 3300009093 Bacteria 387911
75 Ga0114129_10028742 3300009147 Bacteria 7877
76 Ga0105241_10016435 3300009174 Bacteria 5428
77 Ga0105242_10031344 3300009176 Bacteria 4245
78 Ga0105248_10091123 3300009177 Bacteria 3434
79 Ga0105237_10007097 3300009545 Bacteria 12310
80 Ga0105238_10000057 3300009551 Bacteria 134757
81 Ga0105249_10057686 3300009553 Bacteria 3557
82 Ga0105239_10032687 3300010375 Bacteria 5717
83 Ga0157369_10000321 3300013105 Bacteria 64359
84 Ga0157374_10000023 3300013296 Bacteria 265247
85 Ga0157374_10002964 3300013296 Bacteria 14209
86 Ga0157378_10000278 3300013297 Bacteria 49905
87 Ga0157378_10015043 3300013297 Bacteria 6774
88 Ga0157378_10075637 3300013297 Bacteria 3032
89 Ga0157372_10000185 3300013307 Bacteria 69055
90 Ga0157375_10013760 3300013308 Bacteria 7214
91 Ga0157375_10018547 3300013308 Bacteria 6312
92 Ga0163163_10012604 3300014325 Bacteria 7709
93 Ga0163163_10126813 3300014325 Bacteria 2590
94 Ga0157380_10003101 3300014326 Bacteria 11337
95 Ga0157379_10010915 3300014968 Bacteria 7919
96 Ga0157376_10001034 3300014969 Bacteria 18220
97 Ga0157376_10004900 3300014969 Bacteria 9328
98 Ga0157376_10037178 3300014969 Bacteria 3949
99 Ga0163161_10031204 3300017792 Bacteria 3796
100 Ga0213876_10000078 3300021384 Bacteria 110940
101 Ga0213876_10000526 3300021384 Bacteria 29221
102 Ga0207692_10018463 3300025898 Bacteria 3132
103 Ga0207688_10016761 3300025901 Bacteria 3977
104 Ga0207688_10024876 3300025901 Bacteria 3285
105 Ga0207680_10005611 3300025903 Bacteria 6005
106 Ga0207699_10000491 3300025906 Bacteria 19853
107 Ga0207699_10007436 3300025906 Bacteria 5361
108 Ga0207645_10016483 3300025907 Bacteria 4891
109 Ga0207645_10018993 3300025907 Bacteria 4514
110 Ga0207707_10012212 3300025912 Bacteria 7468
111 Ga0207695_10000022 3300025913 Bacteria 659090
112 Ga0207671_10009960 3300025914 Bacteria 7897
113 Ga0207693_10000031 3300025915 Bacteria 117500
114 Ga0207693_10000386 3300025915 Bacteria 40440
115 Ga0207693_10007259 3300025915 Bacteria 9118
116 Ga0207663_10028411 3300025916 Bacteria 3273
117 Ga0207649_10000461 3300025920 Bacteria 29267
118 Ga0207652_10062262 3300025921 Bacteria 3224
119 Ga0207681_10010791 3300025923 Bacteria 5610
120 Ga0207681_10050835 3300025923 Bacteria 2806
121 Ga0207694_10001779 3300025924 Bacteria 18010
122 Ga0207650_10064222 3300025925 Bacteria 2747
123 Ga0207659_10070522 3300025926 Bacteria 2549
124 Ga0207700_10011461 3300025928 Bacteria 5653
125 Ga0207700_10039226 3300025928 Bacteria 3445
126 Ga0207664_10000582 3300025929 Bacteria 25512
127 Ga0207644_10026036 3300025931 Bacteria 4027
128 Ga0207706_10081832 3300025933 Bacteria 2838
129 Ga0207686_10092155 3300025934 Bacteria 2003
130 Ga0207670_10045039 3300025936 Bacteria 2922
131 Ga0207665_10016526 3300025939 Bacteria 4847
132 Ga0207691_10005125 3300025940 Bacteria 12645
133 Ga0207711_10187438 3300025941 Bacteria 1884
134 Ga0207679_10075659 3300025945 Bacteria 2555
135 Ga0207667_10000326 3300025949 Bacteria 66227
136 Ga0207668_10127950 3300025972 Bacteria 1935
137 Ga0207703_10081845 3300026035 Bacteria 2693
138 Ga0207703_10091675 3300026035 Bacteria 2556
139 Ga0207678_10169301 3300026067 Bacteria 1865
140 Ga0207702_10001241 3300026078 Bacteria 25764
141 Ga0207648_10007364 3300026089 Bacteria 10837
142 Ga0207674_10019513 3300026116 Bacteria 7342
143 Ga0207674_10035714 3300026116 Bacteria 5186
144 Ga0207683_10005422 3300026121 Bacteria 10928
145 Ga0207683_10036243 3300026121 Bacteria 4294
146 Ga0207683_10039741 3300026121 Bacteria 4105
147 Ga0209588_1000090 3300027671 Bacteria 28620
148 Ga0268264_10000696 3300028381 Bacteria 39093
149 Ga0265336_10004587 3300028666 Bacteria 5193
150 Ga0265338_10031729 3300028800 Bacteria 5172
151 Ga0265338_10049819 3300028800 Bacteria 3791
152 Ga0265338_10095276 3300028800 Bacteria 2446
153 Ga0265760_10001046 3300031090 Bacteria 8038
154 Ga0265325_10015730 3300031241 Bacteria 4246
155 Ga0265340_10024017 3300031247 Bacteria 3101
156 Ga0265339_10003689 3300031249 Bacteria 10684
157 Ga0373957_0034095 3300035120 Bacteria 1883
158 Ga0373943_0000046 3300035170 Bacteria 41661
159 Ga0373955_0016826 3300035172 Bacteria 3606
160 Ga0316574_0126655 3300035398 Bacteria 1642
161 Ga0373927_0000292 3300035695 Bacteria 39594
162 Ga0373947_0001257 3300035725 Bacteria 15596
163 Ga0373925_0003352 3300037068 Bacteria 12426
164 Ga0436365_0012618 3300039437 Bacteria 53643
165 Ga0436365_1660809 3300039437 Bacteria 51972
166 Ga0451577_0003437 3300042876 Bacteria 17632
167 Ga0466963_0003633 3300044694 Bacteria 8864
168 Ga0466971_0000025 3300044719 Bacteria 62833
169 Ga0466957_0005773 3300044842 Bacteria 6955
170 Ga0466967_0032009 3300045976 Bacteria 4436
171 Ga0495580_0008431 3300046472 Bacteria 8199
172 Ga0495580_0077265 3300046472 Bacteria 2322
173 Ga0495664_0009758 3300046477 Bacteria 5380
174 Ga0495630_0137605 3300046517 Bacteria 1856
175 Ga0495635_0031811 3300046663 Bacteria 3662
176 Ga0495675_0014323 3300047444 Bacteria 5010
177 Ga0495675_0033083 3300047444 Bacteria 3300
178 Ga0495684_0051503 3300047471 Bacteria 3142
179 Ga0495684_0054841 3300047471 Bacteria 3040
180 Ga0495602_0109961 3300048088 Bacteria 2241
181 Ga0496109_0000140 3300048912 Bacteria 72237
182 Ga0496112_0172835 3300048915 Bacteria 2126
183 Ga0496115_0030914 3300048918 Bacteria 4216
184 Ga0496115_0073633 3300048918 Bacteria 2773
185 Ga0496125_0000017 3300048928 Bacteria 508217
186 Ga0501033_0000083 3300049570 Bacteria 89452
187 Ga0501034_0211692 3300049571 Bacteria 1894
188 Ga0501038_0000379 3300049574 Bacteria 38322
189 Ga0501038_0003136 3300049574 Bacteria 15419
190 Ga0501067_0010852 3300049583 Bacteria 5042
191 Ga0501070_0034861 3300049586 Bacteria 4206
192 Ga0501070_0071391 3300049586 Bacteria 2875
193 Ga0501080_0044889 3300049742 Bacteria 4113
194 Ga0501080_0142569 3300049742 Bacteria 2215
195 nmdc:mga05p37_67569_c1 3300050507 Bacteria 4397
196 nmdc:mga0qj67_63632_c1 3300050509 Bacteria 2933
197 nmdc:mga06r32_14503_c1 3300050510 Bacteria 7153
198 nmdc:mga0n895_1202_c1 3300050512 Bacteria 19094
199 Ga0500610_0038514 3300053079 Bacteria 2464
200 Ga0500555_008260 3300053103 Bacteria 2966
201 Ga0500556_0001956 3300053104 Bacteria 7273
202 Ga0500616_0031233 3300053153 Bacteria 2919
203 Ga0466962_0000006 3300061719 Bacteria 168917
204 2787506773 2786546548 Bacteria 4745694
205 rootL2_10165033
206 CNXas_1000029
207 JGI24743J22301_10000934
208 rootL2_10043555
209 Ga0070676_10012869
210 Ga0070670_100009169
211 Ga0070670_100022529
212 Ga0070666_10044545
213 Ga0070661_100000482
214 Ga0070668_100014734
215 Ga0070668_100075796
216 Ga0070668_100104834
217 Ga0070669_100018892
218 Ga0070669_100031789
219 Ga0070675_100020973
220 Ga0070675_100097341
221 Ga0070671_100109305
222 Ga0070674_100067027
223 Ga0070673_100036548
224 Ga0070673_100076851
225 Ga0070659_100005785
226 Ga0070667_100068840
227 Ga0070709_10000171
228 Ga0070714_100000074
229 Ga0070714_100014060
230 Ga0070714_100102430
231 Ga0070713_100000029
232 Ga0070713_100013098
233 Ga0070713_100033301
234 Ga0070710_10012585
235 Ga0070710_10013395
236 Ga0070711_100028501
237 Ga0070711_100028563
238 Ga0070711_100119862
239 Ga0070708_100001145
240 Ga0070678_100016182
241 Ga0070681_10004186
242 Ga0070706_100001703
243 Ga0070699_100045296
244 Ga0070699_100097437
245 Ga0070679_100000869
246 Ga0070684_100019265
247 Ga0070697_100000148
248 Ga0070697_100067471
249 Ga0070665_100019285
250 Ga0068855_100019246
251 Ga0070664_100159611
252 Ga0068857_100005305
253 Ga0068854_100020935
254 Ga0068856_100006941
255 Ga0068864_100014442
256 Ga0068851_10007666
257 Ga0068863_100016967
258 Ga0068858_100031646
259 Ga0068858_100036448
260 Ga0068858_100061385
261 Ga0068860_100000459
262 Ga0068862_100148934
263 Ga0081455_10007864
264 Ga0081538_10018892
265 Ga0081539_10001175
266 Ga0070716_100033605
267 Ga0070712_100000666
268 Ga0070712_100006642
269 Ga0070712_100049004
270 Ga0097621_100003487
271 Ga0097621_100120586
272 Ga0097621_100173675
273 Ga0068871_100000507
274 Ga0075431_100014498
275 Ga0075431_100060257
276 Ga0075435_100089349
277 Ga0099794_10000233
278 Ga0105240_10000022
279 Ga0114129_10028742
280 Ga0105241_10016435
281 Ga0105242_10031344
282 Ga0105248_10091123
283 Ga0105237_10007097
284 Ga0105238_10000057
285 Ga0105249_10057686
286 Ga0105239_10032687
287 Ga0157369_10000321
288 Ga0157374_10000023
289 Ga0157374_10002964
290 Ga0157378_10000278
291 Ga0157378_10015043
292 Ga0157378_10075637
293 Ga0157372_10000185
294 Ga0157375_10013760
295 Ga0157375_10018547
296 Ga0163163_10012604
297 Ga0163163_10126813
298 Ga0157380_10003101
299 Ga0157379_10010915
300 Ga0157376_10001034
301 Ga0157376_10004900
302 Ga0157376_10037178
303 Ga0163161_10031204
304 Ga0213876_10000078
305 Ga0213876_10000526
306 Ga0207692_10018463
307 Ga0207688_10016761
308 Ga0207688_10024876
309 Ga0207680_10005611
310 Ga0207699_10000491
311 Ga0207699_10007436
312 Ga0207645_10016483
313 Ga0207645_10018993
314 Ga0207707_10012212
315 Ga0207695_10000022
316 Ga0207671_10009960
317 Ga0207693_10000031
318 Ga0207693_10000386
319 Ga0207693_10007259
320 Ga0207663_10028411
321 Ga0207649_10000461
322 Ga0207652_10062262
323 Ga0207681_10010791
324 Ga0207681_10050835
325 Ga0207694_10001779
326 Ga0207650_10064222
327 Ga0207659_10070522
328 Ga0207700_10011461
329 Ga0207700_10039226
330 Ga0207664_10000582
331 Ga0207644_10026036
332 Ga0207706_10081832
333 Ga0207686_10092155
334 Ga0207670_10045039
335 Ga0207665_10016526
336 Ga0207691_10005125
337 Ga0207711_10187438
338 Ga0207679_10075659
339 Ga0207667_10000326
340 Ga0207668_10127950
341 Ga0207703_10081845
342 Ga0207703_10091675
343 Ga0207678_10169301
344 Ga0207702_10001241
345 Ga0207648_10007364
346 Ga0207674_10019513
347 Ga0207674_10035714
348 Ga0207683_10005422
349 Ga0207683_10036243
350 Ga0207683_10039741
351 Ga0209588_1000090
352 Ga0268264_10000696
353 Ga0265336_10004587
354 Ga0265338_10031729
355 Ga0265338_10049819
356 Ga0265338_10095276
357 Ga0265760_10001046
358 Ga0265325_10015730
359 Ga0265340_10024017
360 Ga0265339_10003689
361 Ga0373957_0034095
362 Ga0373943_0000046
363 Ga0373955_0016826
364 Ga0316574_0126655
365 Ga0373927_0000292
366 Ga0373947_0001257
367 Ga0373925_0003352
368 Ga0436365_0012618
369 Ga0436365_1660809
370 Ga0451577_0003437
371 Ga0466963_0003633
372 Ga0466971_0000025
373 Ga0466957_0005773
374 Ga0466967_0032009
375 Ga0495580_0008431
376 Ga0495580_0077265
377 Ga0495664_0009758
378 Ga0495630_0137605
379 Ga0495635_0031811
380 Ga0495675_0014323
381 Ga0495675_0033083
382 Ga0495684_0051503
383 Ga0495684_0054841
384 Ga0495602_0109961
385 Ga0496109_0000140
386 Ga0496112_0172835
387 Ga0496115_0030914
388 Ga0496115_0073633
389 Ga0496125_0000017
390 Ga0501033_0000083
391 Ga0501034_0211692
392 Ga0501038_0000379
393 Ga0501038_0003136
394 Ga0501067_0010852
395 Ga0501070_0034861
396 Ga0501070_0071391
397 Ga0501080_0044889
398 Ga0501080_0142569
399 nmdc:mga05p37_67569_c1
400 nmdc:mga0qj67_63632_c1
401 nmdc:mga06r32_14503_c1
402 nmdc:mga0n895_1202_c1
403 Ga0500610_0038514
404 Ga0500555_008260
405 Ga0500556_0001956
406 Ga0500616_0031233
407 Ga0466962_0000006
408 2787506773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

52

471

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wmv-assembly1.cif.gz_A structure of human sglt1-map17 complex bound with lx2761 0.8033 2 495
7sl8-assembly1.cif.gz_A cryoem structure of sglt1 at 3.4 a resolution 0.7942 1 497
7sl9-assembly1.cif.gz_A cryoem structure of smct1 0.7845 1 493
5nva-assembly1.cif.gz_A substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site 0.783 4 496
7yni-assembly1.cif.gz_A structure of human sglt1-map17 complex bound with substrate 4d4fdg in the occluded conformation 0.7785 1 510
ID Description Score Start End Superfamily
af_P32705_52_542_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.911 21 515 1.20.1730.10
af_P32705_52_542_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.9092 21 515 1.20.1730.10
af_P16256_31_481_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.846 30 496 1.20.1730.10
af_P07117_23_496_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8381 25 510 1.20.1730.10
af_Q2FWY7_34_506_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8273 21 513 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A3C0MI19-F1-model_v4 Cation acetate symporter 0.9449 39 475 GO:0005886
GO:0006814
GO:0006847
GO:0015123
GO:0015293
AF-A0A3C0MI19-F1-model_v4 Cation acetate symporter 0.9406 39 475 GO:0005886
GO:0006814
GO:0006847
GO:0015123
GO:0015293
AF-A0A558AZK6-F1-model_v4 Cation acetate symporter 0.9378 1 520 GO:0005886
GO:0006811
GO:0006847
GO:0015123
GO:0015293
AF-A0A7X6PNT1-F1-model_v4 Cation acetate symporter 0.9369 97 522 GO:0005886
GO:0006847
GO:0015123
GO:0015293
AF-A0A7C2BZY2-F1-model_v4 Cation acetate symporter 0.9358 269 513 GO:0005886
GO:0006847
GO:0015123
GO:0015293

Map